Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3767
Gene name	Potassium inwardly rectifying channel subfamily J member 11
Gene symbol	KCNJ11
Synonyms (NCBI Gene)	BIRHHF2IKATPKIR6.2MODY13PHHIPNDM2TNDM3
Chromosome	11
Chromosome location	11p15.1
Summary	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

Show/Hide all (66)

SNP ID	Visualize variation	Clinical significance	Consequence
rs5219	T>A,C,G	Likely-benign, benign, risk-factor, drug-response, benign-likely-benign	Intron variant, missense variant, 5 prime UTR variant, stop gained, coding sequence variant
rs28936678	A>G	Pathogenic	Coding sequence variant, missense variant
rs74162102	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs74339576	C>A,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs80356610	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant
rs80356611	C>A,G,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs80356613	C>G,T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs80356615	C>T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs80356616	C>T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs80356617	A>C	Pathogenic	Missense variant, coding sequence variant, intron variant
rs80356618	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs80356620	T>G	Pathogenic	Missense variant, coding sequence variant
rs80356621	T>C	Pathogenic	Missense variant, coding sequence variant
rs80356622	C>G	Pathogenic	Missense variant, coding sequence variant
rs80356624	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs80356625	G>A	Pathogenic	Missense variant, coding sequence variant
rs104894236	G>A,T	Pathogenic, likely-benign	5 prime UTR variant, coding sequence variant, intron variant, synonymous variant, stop gained
rs104894237	G>A	Pathogenic	Missense variant, coding sequence variant
rs104894248	T>C	Pathogenic	Missense variant, coding sequence variant
rs116392938	G>A	Benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs193922565	A>G	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs193929333	A>C,G	Pathogenic	Coding sequence variant, intron variant, missense variant
rs193929337	T>C	Pathogenic	Coding sequence variant, intron variant, missense variant
rs193929348	T>C	Pathogenic	Coding sequence variant, missense variant
rs193929352	A>G	Pathogenic	Coding sequence variant, missense variant
rs193929353	T>C,G	Pathogenic	Coding sequence variant, missense variant
rs193929355	C>T	Pathogenic	Coding sequence variant, missense variant
rs193929356	T>A,C	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs193929357	A>T	Pathogenic	Coding sequence variant, missense variant
rs193929358	C>T	Pathogenic	Coding sequence variant, missense variant
rs267607196	C>T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs375848765	G>A	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs377091338	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs387906398	C>A	Pathogenic	5 prime UTR variant, intron variant
rs387906783	A>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant, intron variant
rs529946415	A>G	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	5 prime UTR variant, intron variant
rs539975714	C>A	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	5 prime UTR variant, intron variant
rs547932593	C>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Intron variant, 5 prime UTR variant
rs587783669	G>C,T	Likely-pathogenic	Coding sequence variant, missense variant, stop gained
rs587783670	G>C,T	Pathogenic	Coding sequence variant, missense variant
rs587783671	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs587783672	C>T	Pathogenic	Coding sequence variant, missense variant
rs587783673	C>T	Pathogenic	Coding sequence variant, missense variant
rs587783674	G>C	Pathogenic	Coding sequence variant, missense variant, intron variant
rs587783675	A>G	Pathogenic	Coding sequence variant, missense variant
rs750414160	C>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs752507753	G>A	Uncertain-significance, likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs766891274	G>A,T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs780957825	G>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs797045637	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant
rs879253757	G>A	Likely-pathogenic	Stop gained, coding sequence variant, intron variant
rs954727530	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1057518775	G>A,C	Uncertain-significance, likely-pathogenic	Missense variant, intron variant, coding sequence variant
rs1337406718	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1371185696	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1404429785	C>T	Pathogenic	Coding sequence variant, missense variant
rs1554901596	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1554901690	->GATGATC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554901718	->T	Uncertain-significance, likely-pathogenic	Coding sequence variant, frameshift variant
rs1554901775	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554901822	->A	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554901829	AAGG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554901854	->T	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1564865232	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1564865302	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1591695840	A>G	Likely-pathogenic	Missense variant, coding sequence variant

545

Show/Hide all (545)

miRTarBase ID	miRNA	Experiments	Reference
MIRT616628	hsa-miR-339-5p	HITS-CLIP	19536157
MIRT616627	hsa-miR-5193	HITS-CLIP	19536157
MIRT616626	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT616625	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT616624	hsa-miR-8073	HITS-CLIP	19536157
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	19536157
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	19536157
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	19536157
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	19536157
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	19536157
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT616613	hsa-miR-4279	HITS-CLIP	19536157
MIRT616612	hsa-miR-4642	HITS-CLIP	19536157
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	19536157
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT616629	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT616628	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT616627	hsa-miR-5193	HITS-CLIP	23824327
MIRT616626	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616625	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT616624	hsa-miR-8073	HITS-CLIP	23824327
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	23824327
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	23824327
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	23824327
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT646978	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT646977	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616613	hsa-miR-4279	HITS-CLIP	23824327
MIRT616612	hsa-miR-4642	HITS-CLIP	23824327
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT488963	hsa-miR-4673	HITS-CLIP	23824327
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT616629	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT616628	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT616627	hsa-miR-5193	HITS-CLIP	23824327
MIRT616626	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616625	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT616624	hsa-miR-8073	HITS-CLIP	23824327
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	23824327
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	23824327
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	23824327
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616613	hsa-miR-4279	HITS-CLIP	23824327
MIRT616612	hsa-miR-4642	HITS-CLIP	23824327
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT488966	hsa-miR-4514	PAR-CLIP	22012620
MIRT488964	hsa-miR-4692	PAR-CLIP	22012620
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT488963	hsa-miR-4673	PAR-CLIP	22012620
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT488966	hsa-miR-4514	PAR-CLIP	23446348
MIRT488964	hsa-miR-4692	PAR-CLIP	23446348
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT488963	hsa-miR-4673	PAR-CLIP	23446348
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	23592263
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	23592263
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	23592263
MIRT488966	hsa-miR-4514	PAR-CLIP	23592263
MIRT488964	hsa-miR-4692	PAR-CLIP	23592263
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT488963	hsa-miR-4673	PAR-CLIP	23592263
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	23592263
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488966	hsa-miR-4514	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488963	hsa-miR-4673	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488964	hsa-miR-4692	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	27292025
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	27292025
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	27292025
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	27292025
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	27292025
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	27292025
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	27292025
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	27292025
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	27292025
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	27292025
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	27292025
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	27292025
MIRT488966	hsa-miR-4514	PAR-CLIP	27292025
MIRT488966	hsa-miR-4514	PAR-CLIP	27292025
MIRT488966	hsa-miR-4514	PAR-CLIP	27292025
MIRT488966	hsa-miR-4514	PAR-CLIP	27292025
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT488963	hsa-miR-4673	PAR-CLIP	27292025
MIRT488963	hsa-miR-4673	PAR-CLIP	27292025
MIRT488963	hsa-miR-4673	PAR-CLIP	27292025
MIRT488963	hsa-miR-4673	PAR-CLIP	27292025
MIRT488963	hsa-miR-4673	PAR-CLIP	27292025
MIRT488964	hsa-miR-4692	PAR-CLIP	27292025
MIRT488964	hsa-miR-4692	PAR-CLIP	27292025
MIRT488964	hsa-miR-4692	PAR-CLIP	27292025
MIRT488964	hsa-miR-4692	PAR-CLIP	27292025
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	27292025
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	27292025
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	27292025
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	27292025
MIRT616628	hsa-miR-339-5p	HITS-CLIP	19536157
MIRT616627	hsa-miR-5193	HITS-CLIP	19536157
MIRT616626	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT616625	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT616624	hsa-miR-8073	HITS-CLIP	19536157
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	19536157
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	19536157
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	19536157
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	19536157
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	19536157
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT616613	hsa-miR-4279	HITS-CLIP	19536157
MIRT616612	hsa-miR-4642	HITS-CLIP	19536157
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	19536157
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT616629	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT616628	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT616627	hsa-miR-5193	HITS-CLIP	23824327
MIRT616626	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616625	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT616624	hsa-miR-8073	HITS-CLIP	23824327
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	23824327
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	23824327
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	23824327
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT646978	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT646977	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616613	hsa-miR-4279	HITS-CLIP	23824327
MIRT616612	hsa-miR-4642	HITS-CLIP	23824327
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT488963	hsa-miR-4673	HITS-CLIP	23824327
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT616629	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT616628	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT616627	hsa-miR-5193	HITS-CLIP	23824327
MIRT616626	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT616625	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT616624	hsa-miR-8073	HITS-CLIP	23824327
MIRT616623	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT616622	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT616621	hsa-miR-4720-5p	HITS-CLIP	23824327
MIRT616620	hsa-miR-4799-3p	HITS-CLIP	23824327
MIRT616619	hsa-miR-5588-5p	HITS-CLIP	23824327
MIRT616618	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT616617	hsa-miR-1271-3p	HITS-CLIP	23824327
MIRT616616	hsa-miR-550a-3-5p	HITS-CLIP	23824327
MIRT616615	hsa-miR-550a-5p	HITS-CLIP	23824327
MIRT616614	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT616613	hsa-miR-4279	HITS-CLIP	23824327
MIRT616612	hsa-miR-4642	HITS-CLIP	23824327
MIRT616611	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT616610	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT488966	hsa-miR-4514	PAR-CLIP	20371350
MIRT488964	hsa-miR-4692	PAR-CLIP	20371350
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT488963	hsa-miR-4673	PAR-CLIP	20371350
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT488966	hsa-miR-4514	PAR-CLIP	22012620
MIRT488964	hsa-miR-4692	PAR-CLIP	22012620
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT488963	hsa-miR-4673	PAR-CLIP	22012620
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT488966	hsa-miR-4514	PAR-CLIP	23446348
MIRT488964	hsa-miR-4692	PAR-CLIP	23446348
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT488963	hsa-miR-4673	PAR-CLIP	23446348
MIRT488969	hsa-miR-2682-5p	PAR-CLIP	23592263
MIRT488968	hsa-miR-34b-5p	PAR-CLIP	23592263
MIRT488967	hsa-miR-449c-5p	PAR-CLIP	23592263
MIRT488966	hsa-miR-4514	PAR-CLIP	23592263
MIRT488964	hsa-miR-4692	PAR-CLIP	23592263
MIRT488965	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT488963	hsa-miR-4673	PAR-CLIP	23592263
MIRT488962	hsa-miR-548au-3p	PAR-CLIP	23592263
MIRT1081244	hsa-let-7a	CLIP-seq
MIRT1081245	hsa-let-7b	CLIP-seq
MIRT1081246	hsa-let-7c	CLIP-seq
MIRT1081247	hsa-let-7d	CLIP-seq
MIRT1081248	hsa-let-7e	CLIP-seq
MIRT1081249	hsa-let-7f	CLIP-seq
MIRT1081250	hsa-let-7g	CLIP-seq
MIRT1081251	hsa-let-7i	CLIP-seq
MIRT1081252	hsa-miR-1184	CLIP-seq
MIRT1081253	hsa-miR-1205	CLIP-seq
MIRT1081254	hsa-miR-1266	CLIP-seq
MIRT1081255	hsa-miR-1296	CLIP-seq
MIRT1081256	hsa-miR-188-3p	CLIP-seq
MIRT1081257	hsa-miR-1910	CLIP-seq
MIRT1081258	hsa-miR-202	CLIP-seq
MIRT1081259	hsa-miR-2114	CLIP-seq
MIRT1081260	hsa-miR-3064-5p	CLIP-seq
MIRT1081261	hsa-miR-3074-5p	CLIP-seq
MIRT1081262	hsa-miR-3143	CLIP-seq
MIRT1081263	hsa-miR-3158-5p	CLIP-seq
MIRT1081264	hsa-miR-3169	CLIP-seq
MIRT1081265	hsa-miR-3189-3p	CLIP-seq
MIRT1081266	hsa-miR-3622a-3p	CLIP-seq
MIRT1081267	hsa-miR-3622b-3p	CLIP-seq
MIRT1081268	hsa-miR-3649	CLIP-seq
MIRT1081269	hsa-miR-3652	CLIP-seq
MIRT1081270	hsa-miR-3663-3p	CLIP-seq
MIRT1081271	hsa-miR-3682-5p	CLIP-seq
MIRT1081272	hsa-miR-3688-5p	CLIP-seq
MIRT1081273	hsa-miR-370	CLIP-seq
MIRT1081274	hsa-miR-3714	CLIP-seq
MIRT1081275	hsa-miR-412	CLIP-seq
MIRT1081276	hsa-miR-4264	CLIP-seq
MIRT1081277	hsa-miR-4270	CLIP-seq
MIRT1081278	hsa-miR-4291	CLIP-seq
MIRT1081279	hsa-miR-4310	CLIP-seq
MIRT1081280	hsa-miR-4324	CLIP-seq
MIRT1081281	hsa-miR-4329	CLIP-seq
MIRT1081282	hsa-miR-4430	CLIP-seq
MIRT1081283	hsa-miR-4441	CLIP-seq
MIRT1081284	hsa-miR-4446-3p	CLIP-seq
MIRT1081285	hsa-miR-4458	CLIP-seq
MIRT1081286	hsa-miR-4461	CLIP-seq
MIRT1081287	hsa-miR-4470	CLIP-seq
MIRT1081288	hsa-miR-4492	CLIP-seq
MIRT1081289	hsa-miR-4498	CLIP-seq
MIRT1081290	hsa-miR-4500	CLIP-seq
MIRT1081291	hsa-miR-4505	CLIP-seq
MIRT1081292	hsa-miR-4512	CLIP-seq
MIRT1081293	hsa-miR-4515	CLIP-seq
MIRT1081294	hsa-miR-4518	CLIP-seq
MIRT1081295	hsa-miR-455-3p	CLIP-seq
MIRT1081296	hsa-miR-4640-5p	CLIP-seq
MIRT1081297	hsa-miR-4649-3p	CLIP-seq
MIRT1081298	hsa-miR-4663	CLIP-seq
MIRT1081299	hsa-miR-4699-3p	CLIP-seq
MIRT1081300	hsa-miR-4712-5p	CLIP-seq
MIRT1081301	hsa-miR-4726-5p	CLIP-seq
MIRT1081302	hsa-miR-4729	CLIP-seq
MIRT1081303	hsa-miR-4768-3p	CLIP-seq
MIRT1081304	hsa-miR-532-3p	CLIP-seq
MIRT1081305	hsa-miR-543	CLIP-seq
MIRT1081306	hsa-miR-548an	CLIP-seq
MIRT1081307	hsa-miR-552	CLIP-seq
MIRT1081308	hsa-miR-579	CLIP-seq
MIRT1081309	hsa-miR-635	CLIP-seq
MIRT1081310	hsa-miR-762	CLIP-seq
MIRT1081311	hsa-miR-770-5p	CLIP-seq
MIRT1081312	hsa-miR-892b	CLIP-seq
MIRT1081313	hsa-miR-98	CLIP-seq
MIRT1081244	hsa-let-7a	CLIP-seq
MIRT1081245	hsa-let-7b	CLIP-seq
MIRT1081246	hsa-let-7c	CLIP-seq
MIRT1081247	hsa-let-7d	CLIP-seq
MIRT1081248	hsa-let-7e	CLIP-seq
MIRT1081249	hsa-let-7f	CLIP-seq
MIRT1081250	hsa-let-7g	CLIP-seq
MIRT1081251	hsa-let-7i	CLIP-seq
MIRT2020142	hsa-miR-1183	CLIP-seq
MIRT2020143	hsa-miR-1233	CLIP-seq
MIRT2020144	hsa-miR-1914	CLIP-seq
MIRT1081258	hsa-miR-202	CLIP-seq
MIRT2020145	hsa-miR-214	CLIP-seq
MIRT1081261	hsa-miR-3074-5p	CLIP-seq
MIRT1081262	hsa-miR-3143	CLIP-seq
MIRT2020146	hsa-miR-3144-5p	CLIP-seq
MIRT2020147	hsa-miR-3191	CLIP-seq
MIRT2020148	hsa-miR-338-3p	CLIP-seq
MIRT2020149	hsa-miR-3619-5p	CLIP-seq
MIRT1081270	hsa-miR-3663-3p	CLIP-seq
MIRT1081273	hsa-miR-370	CLIP-seq
MIRT2020150	hsa-miR-3975	CLIP-seq
MIRT1081281	hsa-miR-4329	CLIP-seq
MIRT1081285	hsa-miR-4458	CLIP-seq
MIRT1081286	hsa-miR-4461	CLIP-seq
MIRT1081290	hsa-miR-4500	CLIP-seq
MIRT2020151	hsa-miR-4530	CLIP-seq
MIRT1081297	hsa-miR-4649-3p	CLIP-seq
MIRT2020152	hsa-miR-4652-5p	CLIP-seq
MIRT1081298	hsa-miR-4663	CLIP-seq
MIRT2020153	hsa-miR-4687-5p	CLIP-seq
MIRT2020154	hsa-miR-4693-5p	CLIP-seq
MIRT1081302	hsa-miR-4729	CLIP-seq
MIRT1081305	hsa-miR-543	CLIP-seq
MIRT1081307	hsa-miR-552	CLIP-seq
MIRT2020155	hsa-miR-571	CLIP-seq
MIRT2020156	hsa-miR-761	CLIP-seq
MIRT1081313	hsa-miR-98	CLIP-seq
MIRT1081244	hsa-let-7a	CLIP-seq
MIRT1081245	hsa-let-7b	CLIP-seq
MIRT1081246	hsa-let-7c	CLIP-seq
MIRT1081247	hsa-let-7d	CLIP-seq
MIRT1081248	hsa-let-7e	CLIP-seq
MIRT1081249	hsa-let-7f	CLIP-seq
MIRT1081250	hsa-let-7g	CLIP-seq
MIRT1081251	hsa-let-7i	CLIP-seq
MIRT2020142	hsa-miR-1183	CLIP-seq
MIRT2020143	hsa-miR-1233	CLIP-seq
MIRT2251961	hsa-miR-15a	CLIP-seq
MIRT2251962	hsa-miR-15b	CLIP-seq
MIRT2251963	hsa-miR-16	CLIP-seq
MIRT2251964	hsa-miR-195	CLIP-seq
MIRT1081258	hsa-miR-202	CLIP-seq
MIRT2020145	hsa-miR-214	CLIP-seq
MIRT1081261	hsa-miR-3074-5p	CLIP-seq
MIRT1081262	hsa-miR-3143	CLIP-seq
MIRT2251965	hsa-miR-3180-5p	CLIP-seq
MIRT2020148	hsa-miR-338-3p	CLIP-seq
MIRT2020149	hsa-miR-3619-5p	CLIP-seq
MIRT2251966	hsa-miR-3622a-5p	CLIP-seq
MIRT1081270	hsa-miR-3663-3p	CLIP-seq
MIRT1081271	hsa-miR-3682-5p	CLIP-seq
MIRT1081273	hsa-miR-370	CLIP-seq
MIRT2020150	hsa-miR-3975	CLIP-seq
MIRT2251967	hsa-miR-424	CLIP-seq
MIRT2251968	hsa-miR-4269	CLIP-seq
MIRT1081278	hsa-miR-4291	CLIP-seq
MIRT1081279	hsa-miR-4310	CLIP-seq
MIRT2251969	hsa-miR-4323	CLIP-seq
MIRT1081281	hsa-miR-4329	CLIP-seq
MIRT1081285	hsa-miR-4458	CLIP-seq
MIRT1081286	hsa-miR-4461	CLIP-seq
MIRT1081290	hsa-miR-4500	CLIP-seq
MIRT2020151	hsa-miR-4530	CLIP-seq
MIRT1081297	hsa-miR-4649-3p	CLIP-seq
MIRT1081298	hsa-miR-4663	CLIP-seq
MIRT2251970	hsa-miR-4690-3p	CLIP-seq
MIRT2251971	hsa-miR-4691-3p	CLIP-seq
MIRT2020154	hsa-miR-4693-5p	CLIP-seq
MIRT1081299	hsa-miR-4699-3p	CLIP-seq
MIRT2251972	hsa-miR-4705	CLIP-seq
MIRT2251973	hsa-miR-4716-5p	CLIP-seq
MIRT1081302	hsa-miR-4729	CLIP-seq
MIRT2251974	hsa-miR-485-3p	CLIP-seq
MIRT2251975	hsa-miR-497	CLIP-seq
MIRT1081305	hsa-miR-543	CLIP-seq
MIRT1081307	hsa-miR-552	CLIP-seq
MIRT2251976	hsa-miR-564	CLIP-seq
MIRT1081308	hsa-miR-579	CLIP-seq
MIRT2020156	hsa-miR-761	CLIP-seq
MIRT2251977	hsa-miR-922	CLIP-seq
MIRT1081313	hsa-miR-98	CLIP-seq
MIRT1081256	hsa-miR-188-3p	CLIP-seq
MIRT1081261	hsa-miR-3074-5p	CLIP-seq
MIRT2020148	hsa-miR-338-3p	CLIP-seq
MIRT1081273	hsa-miR-370	CLIP-seq
MIRT1081297	hsa-miR-4649-3p	CLIP-seq
MIRT1081298	hsa-miR-4663	CLIP-seq
MIRT2389645	hsa-miR-485-5p	CLIP-seq
MIRT1081307	hsa-miR-552	CLIP-seq
MIRT2555240	hsa-miR-1255a	CLIP-seq
MIRT2555241	hsa-miR-1255b	CLIP-seq
MIRT2555242	hsa-miR-1470	CLIP-seq
MIRT2251961	hsa-miR-15a	CLIP-seq
MIRT2251962	hsa-miR-15b	CLIP-seq
MIRT2251963	hsa-miR-16	CLIP-seq
MIRT2555243	hsa-miR-1909	CLIP-seq
MIRT2555244	hsa-miR-194	CLIP-seq
MIRT2251964	hsa-miR-195	CLIP-seq
MIRT2020145	hsa-miR-214	CLIP-seq
MIRT2555245	hsa-miR-331-3p	CLIP-seq
MIRT2555246	hsa-miR-3591-3p	CLIP-seq
MIRT2020149	hsa-miR-3619-5p	CLIP-seq
MIRT2555247	hsa-miR-3620	CLIP-seq
MIRT2251967	hsa-miR-424	CLIP-seq
MIRT2555248	hsa-miR-4290	CLIP-seq
MIRT2555249	hsa-miR-4308	CLIP-seq
MIRT2555250	hsa-miR-4468	CLIP-seq
MIRT2555251	hsa-miR-4667-3p	CLIP-seq
MIRT2251975	hsa-miR-497	CLIP-seq
MIRT2020156	hsa-miR-761	CLIP-seq
MIRT2555240	hsa-miR-1255a	CLIP-seq
MIRT2555241	hsa-miR-1255b	CLIP-seq
MIRT2555242	hsa-miR-1470	CLIP-seq
MIRT2251961	hsa-miR-15a	CLIP-seq
MIRT2251962	hsa-miR-15b	CLIP-seq
MIRT2251963	hsa-miR-16	CLIP-seq
MIRT2555244	hsa-miR-194	CLIP-seq
MIRT2251964	hsa-miR-195	CLIP-seq
MIRT2020145	hsa-miR-214	CLIP-seq
MIRT2555245	hsa-miR-331-3p	CLIP-seq
MIRT2555246	hsa-miR-3591-3p	CLIP-seq
MIRT2020149	hsa-miR-3619-5p	CLIP-seq
MIRT2555247	hsa-miR-3620	CLIP-seq
MIRT2251967	hsa-miR-424	CLIP-seq
MIRT2555248	hsa-miR-4290	CLIP-seq
MIRT2555249	hsa-miR-4308	CLIP-seq
MIRT2555250	hsa-miR-4468	CLIP-seq
MIRT2555251	hsa-miR-4667-3p	CLIP-seq
MIRT2251975	hsa-miR-497	CLIP-seq
MIRT2020156	hsa-miR-761	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HNF4A	Unknown	17894829

Show/Hide all (68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001508	Process	Action potential	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003229	Process	Ventricular cardiac muscle tissue development	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IDA	19805355
GO:0005515	Function	Protein binding	IPI	19805355, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS	12860923
GO:0005524	Function	ATP binding	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19805355
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8923010
GO:0006006	Process	Glucose metabolic process	IMP	8923010, 15115830
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0008282	Component	Inward rectifying potassium channel	IDA	19805355, 20610380
GO:0008282	Component	Inward rectifying potassium channel	IEA
GO:0008282	Component	Inward rectifying potassium channel	IPI	29286281
GO:0008282	Component	Inward rectifying potassium channel	ISO
GO:0008282	Component	Inward rectifying potassium channel	ISS
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IMP	18073297
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IBA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	IEA
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	ISS
GO:0015272	Function	ATP-activated inward rectifier potassium channel activity	NAS	28842488
GO:0016020	Component	Membrane	IEA
GO:0019829	Function	ATPase-coupled monoatomic cation transmembrane transporter activity	ISS
GO:0030315	Component	T-tubule	IEA
GO:0030315	Component	T-tubule	ISS
GO:0030506	Function	Ankyrin binding	IEA
GO:0030506	Function	Ankyrin binding	IPI	20610380
GO:0030955	Function	Potassium ion binding	TAS	8923010
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033198	Process	Response to ATP	IDA	15583126, 18073297
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0042391	Process	Regulation of membrane potential	IDA	18073297
GO:0044325	Function	Transmembrane transporter binding	IPI	20610380
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IMP	8923010
GO:0046872	Function	Metal ion binding	IEA
GO:0050796	Process	Regulation of insulin secretion	IMP	15115830
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0050877	Process	Nervous system process	IMP	15115830, 18073297
GO:0061762	Process	CAMKK-AMPK signaling cascade	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	NAS	28842488
GO:0098662	Process	Inorganic cation transmembrane transport	ISS
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IDA	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IMP	18945825
GO:0099508	Function	Voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	NAS	18945825
GO:1904638	Process	Response to resveratrol	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	19805355
GO:1990573	Process	Potassium ion import across plasma membrane	IEA
GO:1990573	Process	Potassium ion import across plasma membrane	ISO
GO:1990573	Process	Potassium ion import across plasma membrane	ISS

MIM	HGNC	e!Ensembl
600937	6257	ENSG00000187486

Q14654

Protein name

ATP-sensitive inward rectifier potassium channel 11 (IKATP) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)

Protein function

Inward rectifier potassium channel that forms the pore of ATP-sensitive potassium channels (KATP), regulating potassium permeability as a function of cytoplasmic ATP and ADP concentrations in many different cells (PubMed:29286281, PubMed:3481534

PDB

6C3O , 6C3P , 7S5T , 7S5X , 7S5Y , 7S5Z , 7S60 , 7S61

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	36 → 174	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	181 → 354	Inward rectifier potassium channel C-terminal domain	Domain

Sequence

MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS

Sequence length

390

Interactions

View interactions

1015

Show/Hide Causal Diseases (20)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Atopic eczema	Likely pathogenic	rs1057518775	RCV000415398
Diabetes	Likely pathogenic; Pathogenic	rs80356611	RCV004798749
Diabetes mellitus	Pathogenic; Likely pathogenic	rs587783673, rs587783672, rs587783669, rs80356625, rs193929355	RCV000146117 RCV000146115 RCV000146107 RCV000146113 RCV000146122
Diabetes mellitus, permanent neonatal 2	Likely pathogenic; Pathogenic	rs141145502, rs587783673, rs80356624, rs80356616, rs80356625, rs80356611, rs74339576, rs267607196, rs2496411976, rs766891274	RCV002501960 RCV003338421 RCV001089463 RCV000009201 RCV001089465 RCV001089464 RCV005042016 RCV005042017 RCV003387624 RCV002481620 RCV003387732
Diabetes mellitus, transient neonatal, 3	Likely pathogenic; Pathogenic	rs141145502, rs587783672, rs80356624, rs80356625, rs80356613, rs74339576, rs267607196, rs766891274, rs954727530, rs1371185696	RCV002501960 RCV001329964 RCV000009200 RCV001530196 RCV000009219 RCV005042016 RCV000763231 RCV002481620 RCV005430771 RCV005430432
Familial hyperinsulinism	Likely pathogenic; Pathogenic	rs1554901747, rs775204908, rs377091338, rs1479483693, rs267607196, rs954727530, rs1371185696	RCV005912928 RCV005432803 RCV005925571 RCV005238142 RCV005417424 RCV005431867 RCV005901446
Hyperinsulinemia	Pathogenic; Likely pathogenic	rs80356624, rs1057518775	RCV002227021 RCV000415398
Hyperinsulinemic hypoglycemia, familial, 2	Likely pathogenic; Pathogenic	rs1554901747, rs141145502, rs797045637, rs104894237, rs74339576, rs267607196, rs2496407300, rs766891274, rs954727530, rs1371185696	RCV001506970 RCV002501960 RCV000194466 RCV000009210 RCV000009220 RCV000009223 RCV004576141 RCV000503978 RCV005430771 RCV005430432
Hypertrichosis	Likely pathogenic	rs1057518775	RCV000415398
Hypoglycemia	Likely pathogenic	rs1057518775	RCV000415398
KCNJ11-related disorder	Likely pathogenic; Pathogenic	rs775204908, rs80356616, rs80356611	RCV003336445 RCV005867735 RCV003335022
Maturity-onset diabetes of the young	Likely pathogenic; Pathogenic	rs587783672, rs80356625, rs104894237, rs74339576, rs267607196, rs1371185696	RCV002227076 RCV002227023 RCV002226640 RCV002227030 RCV002226646 RCV002227197
Maturity-onset diabetes of the young type 13	Likely pathogenic; Pathogenic	rs1554901747, rs141145502, rs587783672, rs74339576, rs267607196, rs766891274, rs1564865302	RCV004719070 RCV002501960 RCV000170299 RCV005042016 RCV000763231 RCV002481620 RCV000754813
Monogenic diabetes	Likely pathogenic; Pathogenic	rs954727530	RCV002225111
Neonatal diabetes mellitus	Likely pathogenic; Pathogenic	rs115716690, rs2133379609, rs193929358, rs587783672, rs80356624, rs80356616, rs80356625, rs80356611	RCV002052018 RCV002052019 RCV002052020 RCV002051813 RCV002051777 RCV002051778 RCV002051779 RCV000030103
Neonatal insulin-dependent diabetes mellitus	Pathogenic; Likely pathogenic	rs587783670, rs587783674, rs80356624, rs80356616, rs193929356	RCV000146108 RCV000146121 RCV000146114 RCV000146104 RCV000146124
Permanent neonatal diabetes mellitus	Likely pathogenic; Pathogenic	rs141145502, rs2133380076, rs80356624, rs80356616, rs80356625, rs80356611, rs267607196, rs193929355, rs193929356	RCV001832822 RCV005922713 RCV000009198 RCV000030665 RCV000009202 RCV000009205 RCV000763231 RCV000020360 RCV000020361 RCV002222331
Permanent neonatal diabetes mellitus 1	Pathogenic; Likely pathogenic	rs74339576, rs954727530, rs1371185696	RCV005430458 RCV005430771 RCV005430432
Transitory neonatal diabetes mellitus	Pathogenic	rs80356616, rs80356625, rs193929355	RCV002227022 RCV002227024 RCV002227047
Type 2 diabetes mellitus	Likely pathogenic; Pathogenic	rs141145502, rs587783673, rs104894237, rs74339576, rs267607196, rs2496407839, rs2496409870, rs2496410962, rs2496408893, rs2496411567, rs2496407871, rs2496410564, rs2496409508, rs2496409024, rs1554901822, rs193929356, rs766891274, rs954727530 View all (3 more)	RCV002501960 RCV002226687 RCV003466840 RCV003460444 RCV000763231 RCV003461768 RCV003461769 RCV003469879 RCV003461771 RCV003461772 RCV003469880 RCV003461773 RCV003461774 RCV004576767 RCV004576768 RCV004576769 RCV002226652 RCV002481620 RCV003459641

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
DEND syndrome	Conflicting classifications of pathogenicity	rs1554901822	RCV000626154
Diabetes mellitus type 1	Uncertain significance	rs1393796559	RCV003336590
Glibenclamide response	drug response	rs80356618	RCV002247280
Hyperinsulinemic hypoglycemia	Conflicting classifications of pathogenicity	rs5216, rs587783666	RCV003993826 RCV002227072
Hyperinsulinism, Dominant/Recessive	Uncertain significance; Conflicting classifications of pathogenicity	rs886048034, rs140636367	RCV000285409 RCV000383301
Maturity-onset diabetes of the young type 3	Uncertain significance	rs1393796559	RCV003336590
Neonatal hypoglycemia	Uncertain significance; Conflicting classifications of pathogenicity; Benign	rs587783670, rs587783671, rs80356615, rs193929333, rs193929357	RCV002226804 RCV002226686 RCV002226645 RCV002226651 RCV002226653
sulfonylureas response	drug response	rs193929353	RCV002247374
Transient Neonatal Diabetes, Dominant	Uncertain significance; Conflicting classifications of pathogenicity	rs886048034, rs140636367	RCV000335068 RCV000321704
Type 1 diabetes mellitus 20	Uncertain significance	rs1393796559	RCV003336590

Show/Hide Text Mining Associations (99)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alcohol Related Disorders	Associate	27223594
Amyotrophic Lateral Sclerosis	Associate	29492846
Anxiety Disorders	Associate	27086753
Arrhythmias Cardiac	Associate	24222218
Arteriolosclerosis	Associate	24135527
Atrial Fibrillation	Inhibit	11693772
Atrial Remodeling	Associate	18504616
Attention Deficit Disorder with Hyperactivity	Associate	27555491
Autism Spectrum Disorder	Associate	30377186
Beckwith Wiedemann Syndrome	Associate	27173951, 36339418
Cantu syndrome	Associate	31119887
Cardiomyopathy Dilated	Associate	18504616, 24222218
Central Nervous System Diseases	Associate	30377186
Cerebral Infarction	Associate	37777789, 39826584
Channelopathies	Associate	30092901
Cognition Disorders	Associate	34732776
Cognitive Dysfunction	Associate	27223594
Colonic Neoplasms	Associate	36273131
Colorectal Neoplasms	Associate	21602532
Congenital Abnormalities	Associate	15115830
Congenital adrenal hyperplasia due to 11 Beta hydroxylase deficiency	Associate	33633334
Congenital Hyperinsulinism	Associate	11018078, 11228046, 11395395, 20943779, 20980454, 21411514, 21536946, 21716120, 21968111, 23266803, 23275527, 23345197, 23563683, 23665564, 23869231 View all (21 more)
Coronary Artery Disease	Inhibit	20628649
Coronary Artery Disease	Associate	34385509, 35222579, 37175633
Coronary Disease	Associate	37175633
Death Sudden Cardiac	Associate	24222218
Developmental Defects of Enamel	Associate	34732776
Developmental Delay Epilepsy and Neonatal Diabetes	Associate	16609879, 18073297, 20049716, 22694282, 28083968, 28480665, 28943513, 34999583
Developmental Disabilities	Associate	15115830, 16609879, 19139106, 20022885, 27223594, 27555491, 28943513, 30092901, 34999583
Diabetes Complications	Associate	27802092
Diabetes Gestational	Associate	30239167, 36313769, 37107681
Diabetes Mellitus	Associate	16268330, 16609879, 16885549, 16885550, 17213273, 17259403, 17446535, 18025464, 18073297, 18662362, 19656320, 19951851, 20194712, 20548773, 20929593 View all (46 more)
Diabetes Mellitus Permanent Neonatal	Associate	15115830, 17213273, 17327377, 17446535, 17668386, 17728498, 18162506, 19496967, 19656320, 20220270, 21273495, 21544516, 22796691, 23050777, 23320570 View all (13 more)
Diabetes Mellitus Transient Neonatal 1	Associate	15115830, 16268330, 16609879, 16885549, 17327377, 17446535, 17728498, 18025408, 18073297, 18346985, 18497752, 18556340, 19139106, 19435956, 19951851 View all (37 more)
Diabetes Mellitus Type 1	Associate	21544516, 28938416, 29361385, 30467975, 36418577
Diabetes Mellitus Type 2	Associate	14551916, 17020404, 17259403, 17463248, 18426861, 18598350, 18678618, 19020324, 19033397, 19368707, 19401414, 19491206, 19766903, 19862325, 20142250 View all (37 more)
Diabetic Ketoacidosis	Associate	28173619, 31605659, 34566892, 39420905
Diabetic Nephropathies	Associate	36314849
Diabetic Neuropathies	Associate	27253191
Diabetic Retinopathy	Associate	25573672, 35996512
Drug Hypersensitivity	Associate	20980454
Drug Resistant Epilepsy	Associate	21674179
Epilepsy	Associate	15115830, 19139106, 20022885, 22694282, 23462667, 26268944, 28943513, 36097778
Facial Hemihypertrophy	Associate	27173951
Fetal Macrosomia	Associate	21674179
Genetic Diseases Inborn	Associate	32792356, 38408297
Glioma	Associate	35581384
Glucose Intolerance	Associate	17259403, 30239167
Heart Failure	Associate	18504616, 19685080, 24222218, 25114062
HIV Infections	Inhibit	28398593
Hyperglycemia	Inhibit	23985558
Hyperinsulinism	Associate	20049716, 20980454, 25555642, 29034901, 29493090, 31464105, 33502730, 33762279, 35674212
Hypertension	Associate	18504616, 21765448
Hypoglycemia	Associate	31464105, 35456451
hypoglycemic encephalopathy	Associate	29087246
Hypokalemic Periodic Paralysis	Inhibit	20396605
Infant Newborn Diseases	Associate	34999583
Insulinoma	Associate	33633334, 37107681, 39536727
Intellectual Disability	Associate	23462667
Ketosis	Associate	16885550
Klinefelter Syndrome	Associate	28766502
Learning Disabilities	Associate	22855734, 27555491, 34732776
Leiomyoma	Associate	18569028
Lymphedema	Associate	36410788
Major Affective Disorder 2	Associate	21544516
Mason Type Diabetes	Associate	20194712, 30760653
Maturity Onset Diabetes of the Young Type 1	Associate	34826540
Memory Disorders	Associate	30377186
Mental Disorders	Associate	27086753, 27555491
Microphthalmia Isolated 1	Associate	27173951
Microvascular Angina	Associate	24068186
Motor Disorders	Associate	18073297
Mucocutaneous Lymph Node Syndrome	Associate	20628649
Muscle Weakness	Associate	15115830
Myocardial Ischemia	Associate	24068186
Myocardial Ischemia	Inhibit	37175633
Myocardial Stunning	Associate	19729596
Neoplasms Germ Cell and Embryonal	Associate	11395395
Nervous System Diseases	Associate	22855734
Neuroendocrine Tumors	Associate	39536727
Neurologic Manifestations	Associate	20022885, 22694282, 26268944, 27555491
Obesity	Associate	20712903, 25612568
Pancreatic Neoplasms	Inhibit	28938416
Pancreatitis	Associate	36410788
Pediatric Obesity	Associate	27540106
Polycystic Ovary Syndrome	Associate	22389004
Prediabetic State	Associate	22163043
Pseudoacromegaly with Severe Insulin Resistance	Associate	38408297
Respiratory System Abnormalities	Associate	30092901
Seizures	Associate	34732776
Sleep Apnea Syndromes	Associate	30092901
Sleep Wake Disorders	Stimulate	27555491
Somatoform Disorders	Associate	11395395
Stomach Diseases	Associate	32581184
Stroke	Associate	37777789
Stroke	Inhibit	39826584
Syndrome	Associate	23462667
Uniparental Disomy	Associate	27173951, 36339418
Vitamin K Deficiency	Associate	20396605

KCNJ11 (potassium inwardly rectifying channel subfamily J member 11)