Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3725
Gene name Gene Name - the full gene name approved by the HGNC.	Jun proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	JUN
Synonyms (NCBI Gene) Gene synonyms aliases	AP-1, AP1, c-Jun, cJUN, p39
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p32.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless

Show/Hide all(363)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000868	hsa-miR-15a-5p	Microarray	18362358
MIRT000867	hsa-miR-16-5p	Microarray	18362358
MIRT005128	hsa-miR-30a-5p	pSILAC	18668040
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT006208	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22508041
MIRT020367	hsa-miR-29c-3p	Sequencing	20371350
MIRT027318	hsa-miR-101-3p	Sequencing	20371350
MIRT005128	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT029641	hsa-miR-26b-5p	Microarray	19088304
MIRT048821	hsa-miR-93-5p	CLASH	23622248
MIRT045693	hsa-miR-149-5p	CLASH	23622248
MIRT043728	hsa-miR-342-3p	CLASH	23622248
MIRT053050	hsa-miR-203a-3p	Immunoblot, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR	23552555
MIRT054258	hsa-miR-139-5p	ChIP-seq, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25499265
MIRT054258	hsa-miR-139-5p	ChIP-seq, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25499265
MIRT560411	hsa-miR-4328	PAR-CLIP	20371350
MIRT560410	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT560409	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT560407	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT560408	hsa-miR-633	PAR-CLIP	20371350
MIRT560406	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT502179	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502177	hsa-miR-429	PAR-CLIP	24398324
MIRT502176	hsa-miR-8084	PAR-CLIP	24398324
MIRT502175	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT502174	hsa-miR-374c-5p	PAR-CLIP	24398324
MIRT502173	hsa-miR-655-3p	PAR-CLIP	24398324
MIRT260042	hsa-miR-1321	PAR-CLIP	22100165
MIRT260049	hsa-miR-4739	PAR-CLIP	22100165
MIRT260051	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT403890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443329	hsa-miR-4480	PAR-CLIP	22100165
MIRT443328	hsa-miR-4783-5p	PAR-CLIP	22100165
MIRT115283	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT115286	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT115291	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT115299	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT443327	hsa-miR-3178	PAR-CLIP	22100165
MIRT731173	hsa-miR-1470	qRT-PCR, Luciferase reporter assay, Western blot	25545366
MIRT731173	hsa-miR-1470	qRT-PCR, Luciferase reporter assay, Western blot	25545366
MIRT502178	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979826
MIRT502178	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	27979826
MIRT054258	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, in vivo gain/loss-of-function experiments	32641995
MIRT054258	hsa-miR-139-5p	Western blotting, qRT-PCR, Flow cytometry	34249000
MIRT054258	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, In situ hybridization	32641995
MIRT560411	hsa-miR-4328	PAR-CLIP	20371350
MIRT560410	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT560409	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT560407	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT560408	hsa-miR-633	PAR-CLIP	20371350
MIRT560406	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT502179	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502178	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT502177	hsa-miR-429	PAR-CLIP	24398324
MIRT502176	hsa-miR-8084	PAR-CLIP	24398324
MIRT502175	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT502174	hsa-miR-374c-5p	PAR-CLIP	24398324
MIRT502173	hsa-miR-655-3p	PAR-CLIP	24398324
MIRT260042	hsa-miR-1321	PAR-CLIP	22100165
MIRT260049	hsa-miR-4739	PAR-CLIP	22100165
MIRT260051	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT403890	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443329	hsa-miR-4480	PAR-CLIP	22100165
MIRT443328	hsa-miR-4783-5p	PAR-CLIP	22100165
MIRT115283	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT115286	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT115291	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT115299	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT443327	hsa-miR-3178	PAR-CLIP	22100165
MIRT1078094	hsa-miR-1245b-3p	CLIP-seq
MIRT1078095	hsa-miR-1258	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078097	hsa-miR-1285	CLIP-seq
MIRT1078098	hsa-miR-1322	CLIP-seq
MIRT1078099	hsa-miR-141	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT1078101	hsa-miR-1972	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078103	hsa-miR-200a	CLIP-seq
MIRT1078104	hsa-miR-200b	CLIP-seq
MIRT1078105	hsa-miR-200c	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT1078107	hsa-miR-216b	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT1078110	hsa-miR-298	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT1078115	hsa-miR-3173-3p	CLIP-seq
MIRT1078116	hsa-miR-3187-5p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT1078121	hsa-miR-3714	CLIP-seq
MIRT1078122	hsa-miR-374c	CLIP-seq
MIRT1078123	hsa-miR-3943	CLIP-seq
MIRT1078124	hsa-miR-4277	CLIP-seq
MIRT1078125	hsa-miR-4428	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT1078127	hsa-miR-4477b	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT1078131	hsa-miR-4659a-3p	CLIP-seq
MIRT1078132	hsa-miR-4659b-3p	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078135	hsa-miR-4672	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT1078137	hsa-miR-4690-3p	CLIP-seq
MIRT1078138	hsa-miR-4699-3p	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078143	hsa-miR-4729	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT1078146	hsa-miR-4762-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT1078148	hsa-miR-499-3p	CLIP-seq
MIRT1078149	hsa-miR-499a-3p	CLIP-seq
MIRT1078150	hsa-miR-513c	CLIP-seq
MIRT1078151	hsa-miR-514b-5p	CLIP-seq
MIRT1078152	hsa-miR-520d-5p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT1078154	hsa-miR-524-5p	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT1078156	hsa-miR-583	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078159	hsa-miR-599	CLIP-seq
MIRT1078160	hsa-miR-612	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078164	hsa-miR-655	CLIP-seq
MIRT1078165	hsa-miR-759	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078169	hsa-miR-940	CLIP-seq
MIRT1078094	hsa-miR-1245b-3p	CLIP-seq
MIRT2019460	hsa-miR-1261	CLIP-seq
MIRT1078098	hsa-miR-1322	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078110	hsa-miR-298	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT2019461	hsa-miR-3119	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT2019462	hsa-miR-3130-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT2019463	hsa-miR-3168	CLIP-seq
MIRT2019464	hsa-miR-323b-3p	CLIP-seq
MIRT2019465	hsa-miR-340	CLIP-seq
MIRT2019466	hsa-miR-3605-3p	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT2019467	hsa-miR-3917	CLIP-seq
MIRT2019468	hsa-miR-4278	CLIP-seq
MIRT2019469	hsa-miR-4436a	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT2019470	hsa-miR-4482	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT2019472	hsa-miR-455-3p	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078131	hsa-miR-4659a-3p	CLIP-seq
MIRT1078132	hsa-miR-4659b-3p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2019474	hsa-miR-4715-3p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT2019475	hsa-miR-4727-5p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2019476	hsa-miR-4768-5p	CLIP-seq
MIRT2019477	hsa-miR-4769-3p	CLIP-seq
MIRT1078150	hsa-miR-513c	CLIP-seq
MIRT1078151	hsa-miR-514b-5p	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT1078156	hsa-miR-583	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT2019478	hsa-miR-890	CLIP-seq
MIRT2019479	hsa-miR-891b	CLIP-seq
MIRT2251289	hsa-miR-1247	CLIP-seq
MIRT1078095	hsa-miR-1258	CLIP-seq
MIRT2019460	hsa-miR-1261	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT2251290	hsa-miR-1587	CLIP-seq
MIRT1078101	hsa-miR-1972	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078104	hsa-miR-200b	CLIP-seq
MIRT1078105	hsa-miR-200c	CLIP-seq
MIRT2251291	hsa-miR-203	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT2251292	hsa-miR-2277-5p	CLIP-seq
MIRT1078108	hsa-miR-24	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT2019461	hsa-miR-3119	CLIP-seq
MIRT1078112	hsa-miR-3120-5p	CLIP-seq
MIRT2019462	hsa-miR-3130-5p	CLIP-seq
MIRT1078113	hsa-miR-3137	CLIP-seq
MIRT1078114	hsa-miR-3152-3p	CLIP-seq
MIRT1078115	hsa-miR-3173-3p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT2019466	hsa-miR-3605-3p	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT1078121	hsa-miR-3714	CLIP-seq
MIRT1078122	hsa-miR-374c	CLIP-seq
MIRT2251293	hsa-miR-4252	CLIP-seq
MIRT2251294	hsa-miR-4263	CLIP-seq
MIRT2251295	hsa-miR-4264	CLIP-seq
MIRT1078124	hsa-miR-4277	CLIP-seq
MIRT2251296	hsa-miR-4417	CLIP-seq
MIRT1078125	hsa-miR-4428	CLIP-seq
MIRT2019469	hsa-miR-4436a	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT1078127	hsa-miR-4477b	CLIP-seq
MIRT2019470	hsa-miR-4482	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT2251297	hsa-miR-4492	CLIP-seq
MIRT2251298	hsa-miR-4498	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT2019472	hsa-miR-455-3p	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT2251299	hsa-miR-4645-3p	CLIP-seq
MIRT2251300	hsa-miR-4656	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078135	hsa-miR-4672	CLIP-seq
MIRT2251301	hsa-miR-4675	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT2251302	hsa-miR-4694-3p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2251303	hsa-miR-4706	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT1078140	hsa-miR-4719	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078143	hsa-miR-4729	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT2251304	hsa-miR-4741	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2251305	hsa-miR-4749-5p	CLIP-seq
MIRT2251306	hsa-miR-4772-3p	CLIP-seq
MIRT2251307	hsa-miR-4797-3p	CLIP-seq
MIRT2251308	hsa-miR-4799-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT2251309	hsa-miR-495	CLIP-seq
MIRT1078148	hsa-miR-499-3p	CLIP-seq
MIRT1078149	hsa-miR-499a-3p	CLIP-seq
MIRT1078152	hsa-miR-520d-5p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT1078154	hsa-miR-524-5p	CLIP-seq
MIRT2251310	hsa-miR-576-5p	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078158	hsa-miR-593	CLIP-seq
MIRT1078159	hsa-miR-599	CLIP-seq
MIRT2251312	hsa-miR-617	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT2251313	hsa-miR-642a	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078164	hsa-miR-655	CLIP-seq
MIRT2251314	hsa-miR-762	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2019478	hsa-miR-890	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078169	hsa-miR-940	CLIP-seq
MIRT2389566	hsa-miR-1260	CLIP-seq
MIRT2389567	hsa-miR-1260b	CLIP-seq
MIRT1078100	hsa-miR-1468	CLIP-seq
MIRT2389568	hsa-miR-188-3p	CLIP-seq
MIRT1078102	hsa-miR-1976	CLIP-seq
MIRT1078106	hsa-miR-2116	CLIP-seq
MIRT2251292	hsa-miR-2277-5p	CLIP-seq
MIRT1078109	hsa-miR-25	CLIP-seq
MIRT2389569	hsa-miR-3156-3p	CLIP-seq
MIRT1078117	hsa-miR-32	CLIP-seq
MIRT1078118	hsa-miR-363	CLIP-seq
MIRT2389570	hsa-miR-3667-3p	CLIP-seq
MIRT1078119	hsa-miR-367	CLIP-seq
MIRT2389571	hsa-miR-4301	CLIP-seq
MIRT1078126	hsa-miR-4469	CLIP-seq
MIRT2019471	hsa-miR-4488	CLIP-seq
MIRT1078129	hsa-miR-4632	CLIP-seq
MIRT2389572	hsa-miR-4636	CLIP-seq
MIRT1078130	hsa-miR-4640-3p	CLIP-seq
MIRT1078134	hsa-miR-4667-3p	CLIP-seq
MIRT1078136	hsa-miR-4677-5p	CLIP-seq
MIRT2019473	hsa-miR-4697-5p	CLIP-seq
MIRT2251303	hsa-miR-4706	CLIP-seq
MIRT1078141	hsa-miR-4722-3p	CLIP-seq
MIRT1078145	hsa-miR-4749-3p	CLIP-seq
MIRT2251305	hsa-miR-4749-5p	CLIP-seq
MIRT2389573	hsa-miR-517a	CLIP-seq
MIRT2389574	hsa-miR-517b	CLIP-seq
MIRT2389575	hsa-miR-517c	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078167	hsa-miR-92a	CLIP-seq
MIRT1078168	hsa-miR-92b	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT1078111	hsa-miR-3074-5p	CLIP-seq
MIRT2554628	hsa-miR-3121-5p	CLIP-seq
MIRT2554629	hsa-miR-3143	CLIP-seq
MIRT2019465	hsa-miR-340	CLIP-seq
MIRT2554630	hsa-miR-362-5p	CLIP-seq
MIRT1078120	hsa-miR-370	CLIP-seq
MIRT2554631	hsa-miR-4282	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT2554632	hsa-miR-4528	CLIP-seq
MIRT2554633	hsa-miR-4637	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT2251302	hsa-miR-4694-3p	CLIP-seq
MIRT1078139	hsa-miR-4711-5p	CLIP-seq
MIRT2019474	hsa-miR-4715-3p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT1078147	hsa-miR-490-3p	CLIP-seq
MIRT2554634	hsa-miR-494	CLIP-seq
MIRT2554635	hsa-miR-500b	CLIP-seq
MIRT2554636	hsa-miR-501-5p	CLIP-seq
MIRT2554637	hsa-miR-513a-3p	CLIP-seq
MIRT1078153	hsa-miR-522	CLIP-seq
MIRT2554638	hsa-miR-543	CLIP-seq
MIRT1078155	hsa-miR-580	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078157	hsa-miR-591	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078163	hsa-miR-649	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2554639	hsa-miR-9	CLIP-seq
MIRT1078096	hsa-miR-1275	CLIP-seq
MIRT2554628	hsa-miR-3121-5p	CLIP-seq
MIRT2554630	hsa-miR-362-5p	CLIP-seq
MIRT1078128	hsa-miR-4525	CLIP-seq
MIRT1078133	hsa-miR-4665-5p	CLIP-seq
MIRT1078142	hsa-miR-4723-5p	CLIP-seq
MIRT1078144	hsa-miR-4731-5p	CLIP-seq
MIRT2554634	hsa-miR-494	CLIP-seq
MIRT2554635	hsa-miR-500b	CLIP-seq
MIRT2554636	hsa-miR-501-5p	CLIP-seq
MIRT2251311	hsa-miR-587	CLIP-seq
MIRT1078161	hsa-miR-625	CLIP-seq
MIRT1078162	hsa-miR-637	CLIP-seq
MIRT1078166	hsa-miR-765	CLIP-seq
MIRT2554639	hsa-miR-9	CLIP-seq

Transcription factors

Show/Hide all(38)

Transcription factor	Regulation	Reference
ABL1	Activation	15145216
ABL1	Repression	19357699
AR	Activation	20148354
ARNT	Repression	21544813
ATF2	Activation	9502786
CREB1	Repression	8647095
CREB1	Unknown	10403485
CTNNB1	Activation	20300972
CTNNB1	Unknown	19671687
ESR1	Activation	11477071
ESR1	Unknown	10037443
ESR2	Unknown	10037443
GLI1	Unknown	19219074
GLI2	Unknown	19219074
HDAC3	Repression	17244530
HDAC4	Activation	10523670
HDAC4	Repression	10523670
HSF1	Unknown	24127737
JUN	Activation	9502786
JUN	Unknown	19671687
MEF2A	Activation	12054430
MEF2A	Unknown	10403485
MEF2C	Activation	10523670;12054430
MEF2C	Repression	10523670
MEF2C	Unknown	10849446
MEF2D	Activation	12054430
NFIC	Unknown	10403485
NFRKB	Activation	22291976
PARP1	Unknown	16026317
PITX1	Repression	21425961
RUNX1	Activation	20959602
SMAD3	Unknown	10022869
SMAD4	Unknown	10022869
TCF4	Unknown	19671687
TNFAIP3	Repression	19124729
WT1	Activation	20842112
ZNF382	Repression	20682794
ZNF383	Repression	15964543

Show/Hide all(99)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	2833704
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21113145
GO:0000228	Component	Nuclear chromosome	TAS	10918580
GO:0000785	Component	Chromatin	IDA	31341047
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	2833704, 9732876, 14645924, 21113145, 22083952, 24623306
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2833704, 19861239, 21113145
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	2833704
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2833704, 19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001889	Process	Liver development	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2825349
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9732876, 31341047
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005096	Function	GTPase activator activity	IDA	11804590
GO:0005515	Function	Protein binding	IPI	7816143, 8440710, 10327051, 10393177, 10428834, 11738026, 15334056, 15378002, 15626733, 15894542, 16291755, 16533805, 18003900, 18172215, 19028685, 19064921, 19074269, 19527717, 20102225, 20195357, 20511396, 20557936, 20852630, 20936779, 21199371, 21555589, 21988832, 22327296, 23602
GO:0005634	Component	Nucleus	IDA	9443941, 12370307, 21113145
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	8628277, 17283046
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	9510247, 20102225, 23661758
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	9732876
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0019046	Process	Release from viral latency	IDA	34893887
GO:0019046	Process	Release from viral latency	IDA	31341047
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030224	Process	Monocyte differentiation	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14739464
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	21113145
GO:0035026	Process	Leading edge cell differentiation	IEA
GO:0035497	Function	CAMP response element binding	IDA	19861239
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860, 16327802
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IMP	26514923
GO:0035976	Component	Transcription factor AP-1 complex	IPI	7816143, 8662824, 9510247
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042802	Function	Identical protein binding	IPI	8662824, 20102225, 25609649
GO:0043065	Process	Positive regulation of apoptotic process	IMP	10508860
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043392	Process	Negative regulation of DNA binding	IDA	14645924
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	2833704
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	2833704
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	27458189
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	2833704
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	2833704, 9732876, 22083952
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2833704, 10508860, 12490281, 19861239, 24623306
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	1406655
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048545	Process	Response to steroid hormone	IBA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	9732876
GO:0061029	Process	Eyelid development in camera-type eye	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10508860, 16007074, 19861239
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070412	Function	R-SMAD binding	IPI	9732876
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0072740	Process	Cellular response to anisomycin	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140296	Function	General transcription initiation factor binding	IPI	12676957
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	24375836
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	28701355
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000144	Process	Positive regulation of DNA-templated transcription initiation	IDA	23027619

MIM	HGNC	e!Ensembl
165160	6204	ENSG00000177606

Protein

UniProt ID

P05412

Protein name

Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)

Protein function

Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed:10995748, PubMed:22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA bind

PDB

1A02 , 1FOS , 1JNM , 1JUN , 1S9K , 1T2K , 5FV8 , 5T01 , 6Y3V , 8SOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	5 → 241	Jun-like transcription factor	Family
PF00170	bZIP_1	250 → 313	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the developing and adult prostate and prostate cancer cells. {ECO:0000269|PubMed:24263171, ECO:0000269|PubMed:24559171}.

Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Sequence length

331

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (219)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidemia isovaleric	Associate	27391542
Acne Vulgaris	Associate	30148860
Acrocephalosyndactylia	Stimulate	23404329
Adenocarcinoma	Associate	18992165
Adenocarcinoma of Lung	Associate	33299528, 7529661
Adenoma	Stimulate	18992165
Alzheimer Disease	Stimulate	17712163, 8774439
Alzheimer Disease	Associate	19162185, 24346217, 32437347, 38049398, 40363838, 8063812, 9880041
Amyotrophic Lateral Sclerosis	Associate	28366453, 37488208
Anodontia	Stimulate	33318474
Aortic Valve Stenosis	Associate	39766890
Arthritis Rheumatoid	Associate	31338093, 32840301, 7822331, 8660103, 9797555
Asthma	Associate	39465738
Astrocytoma	Associate	17971243
Ataxia Telangiectasia	Associate	11278277, 9830038
Atherosclerosis	Associate	22092038, 31330988
Aural Atresia Congenital	Stimulate	19162185
Barrett Esophagus	Associate	1398227
Bone Diseases	Associate	25808168, 37310848
Breast Neoplasms	Associate	12072430, 15319452, 17846503, 19052522, 1906001, 19553068, 19687301, 20219890, 20339243, 20459645, 20482821, 20511396, 20554528, 21785467, 21860415 View all (20 more)
Breast Neoplasms	Inhibit	40666524
Carcinogenesis	Associate	11514621, 16520839, 17416736, 17686773, 18219112, 18923650, 18992165, 19435822, 21245048, 23922701, 24073962, 26581505, 28684765, 30488826, 30523154, 35263597, 37310848, 37779141 View all (3 more)
Carcinoma Basal Cell	Associate	23660123, 32319607
Carcinoma Hepatocellular	Associate	14530285, 21862593, 23844083, 26718209, 26964667, 27431384, 27894081, 28323861, 30565389, 35414777, 36764493, 36941472, 37215991, 9030721
Carcinoma Non Small Cell Lung	Associate	11559711, 14965369, 19018257, 25058399, 26549806, 27533465, 29858032, 37192591
Carcinoma Ovarian Epithelial	Associate	28713952
Carcinoma Renal Cell	Associate	31789394, 32596961
Carcinoma Squamous Cell	Associate	30488826, 39354528
Cell Transformation Neoplastic	Associate	18219112
Cholangiocarcinoma	Associate	26501139, 30305612, 30850583, 33431813
Cholestasis	Associate	27490694
Chondrosarcoma	Associate	24472657, 25823818
Choriocarcinoma	Associate	10712588, 18362896
Colitis Ulcerative	Associate	24118792, 28751935
Colonic Neoplasms	Associate	15754327, 16449643, 18032824
Colorectal Neoplasms	Associate	12707033, 16343055, 17510524, 18534616, 18992165, 20460455, 22489574, 22870247, 23616010, 23693020, 23800415, 31217031, 31506433, 32408577, 32641980 View all (4 more)
Colorectal Neoplasms	Stimulate	23588207
Congenital bilateral aplasia of vas deferens	Associate	32054096
Coronary Artery Disease	Associate	28794385, 30961613, 31014396
Coronary Disease	Associate	31014396
Cough	Associate	39465738
COVID 19	Associate	35855804
Death	Associate	28790303, 35603508, 39354528
Death	Stimulate	8219202
Dermatitis Atopic	Associate	11121152, 16354184
Developmental Defects of Enamel	Associate	19164581
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	30488826
Disease	Stimulate	28424250
Drug Related Side Effects and Adverse Reactions	Associate	11352915, 27490694, 29442453
Dyskinesias	Associate	16050486
Dyslexia	Associate	21555589
Dyslipidemias	Associate	30709899
Ectodermal Dysplasia	Associate	36197437
Encephalocele	Associate	12384753
Endocrine System Diseases	Associate	24564526
Endometrial Neoplasms	Associate	10393530, 32083122, 8701784
Endometriosis	Associate	19074548, 24500404
Epidermolysis Bullosa Dystrophica	Associate	8143767
Esophageal Neoplasms	Associate	19164283, 26858249, 33793074
Esophageal Neoplasms	Inhibit	24796531
Esophageal Squamous Cell Carcinoma	Associate	19164283, 24796531, 25915860, 27689325
Familial cylindromatosis	Inhibit	22832488
Fasciitis	Associate	29061731
Fibrocartilaginous embolism	Associate	32572902
Fibrocystic Breast Disease	Associate	15319452
Fibrosarcoma	Associate	20590612
Fibrosis	Associate	20484496, 28424250
Fibrous Dysplasia of Bone	Associate	39766890
Focal Cortical Dysplasia	Associate	29162878
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	16050486
Gallbladder Neoplasms	Associate	29693707
Gastrointestinal Neoplasms	Associate	9442092
Glioblastoma	Associate	11352915, 21245048, 24732116, 28036297, 30572904, 35538663, 36850002
Glioma	Associate	16303762, 24325785, 26418950, 27956703, 28036297, 30572904, 30927504, 32902145, 34887392, 34959221
Glomerulonephritis IGA	Associate	1712408, 39696012
Glut1 Deficiency Syndrome	Associate	35819574
Graves Ophthalmopathy	Associate	22554965
Head and Neck Neoplasms	Associate	23455325, 9119742
Helicobacter Infections	Associate	16707434
Hemoglobinuria Paroxysmal	Associate	28630090
Hemolysis	Associate	19608687, 37608082
Hemolytic Uremic Syndrome	Associate	23809614
Hepatitis B	Associate	36916737
Hepatitis C	Associate	23844083, 30565389
Hereditary leiomyomatosis and renal cell cancer	Associate	1731522
Hexokinase Deficiency Hemolytic Anemia	Associate	19608687
Hippocampal Sclerosis	Associate	29162878
HIV Infections	Associate	39519306
Hodgkin Disease	Associate	12145210, 30375407
Hypercholesterolemia	Associate	30709899, 31330988
Hyperplasia	Associate	21505178
Hypoglycemia	Associate	9115218
Hypoxia	Associate	10212278, 11739718, 12737630, 12939282, 27486656
Hypoxia	Stimulate	19794957, 25573199, 8910439
Hypoxia Brain	Associate	10212278, 30864710
Hypoxia Brain	Stimulate	8035787, 8065332
Idiopathic Pulmonary Fibrosis	Stimulate	28424250
Idiopathic Pulmonary Fibrosis	Associate	32899090, 40294812
Infections	Stimulate	11665982, 23797008
Infections	Associate	11909956, 15270850, 16306573, 9094704
Inflammation	Associate	12832416, 15504750, 16343055, 16359550, 19162185, 19403722, 19553068, 21454713, 21808000, 22092038, 24500404, 25040843, 26792858, 27207326, 27956552 View all (17 more)
Inflammation	Stimulate	8660103
Insulin Resistance	Associate	19403722
Intervertebral Disc Degeneration	Associate	32572902
Intervertebral disc disease	Associate	12384753
Intervertebral Disc Displacement	Associate	12384753
Kidney Diseases	Stimulate	28424250
Kidney Neoplasms	Associate	31672701
Labor Pain	Associate	30235753
Leiomyoma	Associate	18692824
Leukemia	Associate	10936867, 11226825, 19298651, 21702955, 22825467, 36899005, 8157646, 8348968
Leukemia Large Granular Lymphocytic	Associate	17162379
Leukemia Lymphocytic Chronic B Cell	Associate	36899005
Leukemia Lymphoma Adult T Cell	Associate	12393612, 22553204, 9234684
Leukemia Myeloid	Associate	1310062, 20227498, 2105946, 2122980, 2174893, 7521696
Leukemia Myeloid Acute	Associate	15911090, 19010914, 20376080, 20945381, 22096027, 23247046, 2477086, 31533028, 32635894, 36333583, 39251712
Leukemia Myeloid Acute	Stimulate	19298651
Leukemia Promyelocytic Acute	Associate	26486083
Li Fraumeni Syndrome	Associate	10611334
Liver Failure	Associate	35338348, 37175814
Lung Neoplasms	Associate	14965369, 28618937, 35263597, 37192591, 40294812, 9671482
Lung Neoplasms	Inhibit	18644994
Lupus Erythematosus Systemic	Associate	22354960, 22489574, 30715676, 9822266
Lymphatic Metastasis	Associate	36163022
Lymphoma	Associate	19937141, 25070240, 30375407
Lymphoma B Cell Marginal Zone	Associate	15507668
Lymphoma Large B Cell Diffuse	Associate	26747248, 31794606
Lymphoma Large Cell Anaplastic	Associate	12145210, 17416736, 20511667, 22899583, 25987255, 29588546
Lymphoma T Cell	Associate	34936696
Macular Degeneration	Associate	29670082
Malformations of Cortical Development Group I	Associate	14617628
Malignant mesenchymal tumor	Stimulate	30877256
Melanoma	Associate	10318823, 10353757, 11557318, 14717848, 15492115, 16798740, 1712822, 17482134, 22832488, 25046326, 25793618, 25814555, 27050748, 31378787, 32134466, 35008862, 35926467 View all (2 more)
Mesenteric Ischemia	Associate	24346217
Mitochondrial Diseases	Associate	20338993, 33097606
Mouth Neoplasms	Associate	16520839, 30488826, 32265484
Multiple Myeloma	Associate	15467434, 17545547, 22276160, 26282073, 9639523
Multiple Sclerosis	Associate	10550297
Muscular Disorders Atrophic	Associate	29670082
Myelodysplastic Syndromes	Associate	22559819
Myoclonic Epilepsies Progressive	Associate	30375407
Nasopharyngeal Carcinoma	Associate	19860880, 24157866, 25958199, 28269757, 28672814, 31907338, 32641685, 33122398
Neoplasm Invasiveness	Associate	16449643
Neoplasm Metastasis	Associate	15208657, 22832488, 24362328, 26035356, 26718209, 27078844, 27604827, 27882939, 30877256, 31907338, 33402468, 35955737, 37310848, 39390002, 7822331
Neoplasm Metastasis	Inhibit	36476606
Neoplasms	Associate	11352915, 11514621, 11733515, 11867732, 12145210, 12547826, 1406636, 14519946, 15161022, 1545811, 15514944, 15800680, 16306573, 16343055, 16449643 View all (62 more)
Neoplasms Squamous Cell	Associate	25656613, 27132513
Nerve Degeneration	Associate	24349175, 38049398, 8774439
Neuroblastoma	Associate	12101231, 14617628, 40149013
Neurodegenerative Diseases	Associate	28366453
Neurologic Manifestations	Associate	26475677
Neuroma	Stimulate	39362479
Non alcoholic Fatty Liver Disease	Stimulate	28424250
Non alcoholic Fatty Liver Disease	Associate	34808393
Oncogene Addiction	Associate	26996564
Oral Submucous Fibrosis	Associate	30488826
Osteoarthritis	Associate	12507586, 15498796, 32140068, 33097606
Osteoarthritis Knee	Associate	30893847
Osteoglophonic dwarfism	Associate	31251836
Osteoporosis	Associate	36626454
Osteosarcoma	Associate	17412493, 24025361, 8076631
Ovarian Neoplasms	Associate	10228559, 12637505, 12785726, 17434164, 24865582, 35351053, 37420173, 39954656, 9774447
Pancreatic Neoplasms	Associate	19435822, 23727582, 30584464, 40305202
Pancreatic Neoplasms	Stimulate	21196815
Peritoneal Fibrosis	Associate	12753293
Pharyngeal Neoplasms	Associate	26001294
Precancerous Conditions	Associate	12547826
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22825467
Preeclamptic toxemia	Associate	24120378
Premature Birth	Associate	30235753
Primary Myelofibrosis	Associate	28424250, 31678370
Progeria	Associate	32208162
Prostatic Hyperplasia	Associate	17702894
Prostatic Neoplasms	Associate	17346688, 17634427, 23752183, 25483191, 27604827, 28394299, 30483762, 32414345, 38087324
Prostatic Neoplasms Castration Resistant	Associate	23319273, 35022313
Prostatitis	Associate	16238095, 17634427, 21245048
Pseudomonas Infections	Stimulate	35897707
Psoriasis	Inhibit	1940437
Psoriasis	Associate	7822331
Pulmonary Arterial Hypertension	Associate	28424250
Pulmonary Disease Chronic Obstructive	Inhibit	22409248
Pulmonary Disease Chronic Obstructive	Associate	22413812
Rhabdomyosarcoma	Associate	23797008
Rhabdomyosarcoma Embryonal	Associate	12359053
Rhinitis Allergic	Associate	34278468
Ring Chromosome 20 Syndrome	Stimulate	31251836
Sarcoma Ewing	Associate	14550555, 37599787, 39201282
Sarcoma Synovial	Associate	26850593
Scleroderma Systemic	Associate	28424250
Sepsis	Associate	37773725
Skin Diseases	Associate	39465738
Skin Neoplasms	Associate	31729200
Sleep Deprivation	Associate	10713077
Sleep Disorders Circadian Rhythm	Associate	20353996
Small Cell Lung Carcinoma	Associate	9092556
Spinocerebellar Ataxia Autosomal Recessive 2	Associate	12775760
Squamous Cell Carcinoma of Head and Neck	Associate	16520839, 19671684, 23455325, 24398980, 25945837, 28751006, 28790303, 30488826, 36163022, 9119742
Status Asthmaticus	Associate	20543003
Stomach Neoplasms	Associate	15069708, 15161022, 16474375, 16769709, 19371443, 20939893, 25875631, 26035356, 27078844, 27882939, 30683841, 31249448, 33435161, 35169855, 36171622
Systemic Inflammatory Response Syndrome	Associate	24346217
Tachycardia Atrioventricular Nodal Reentry	Associate	40239580
Thymic epithelial tumor	Associate	22974165
Thymoma	Associate	22974165
Thyroid cancer medullary	Associate	2115330
Thyroid Carcinoma Anaplastic	Associate	37675898
Tinnitus	Associate	36401375
Tongue Neoplasms	Associate	26581505
Triple Negative Breast Neoplasms	Associate	26792858, 27758885, 31931653, 35022313, 36969705, 37551997
Tuberculosis Multidrug Resistant	Associate	22870247
Tuberculosis Pulmonary	Associate	15117956
Uremia	Associate	23809614
Urethral Neoplasms	Associate	24349176
Urinary Bladder Neoplasms	Associate	23922701, 27556506, 28358415, 31401412, 36045117
Uterine Cervical Dysplasia	Associate	18992165, 24796531
Uterine Cervical Neoplasms	Associate	15308638, 15514944, 21937452, 22405256, 24481121, 33303976, 35831303, 8985358
Uterine Cervical Neoplasms	Stimulate	28684765
Varicose Ulcer	Associate	27400471
Vascular Remodeling	Associate	25726846
Wounds and Injuries	Associate	24346217, 27431384

JUN (Jun proto-oncogene, AP-1 transcription factor subunit)