Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3661
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon regulatory factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRF3
Synonyms (NCBI Gene) Gene synonyms aliases	IIAE7
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IIAE7
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to th

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs143769046	C>T	Likely-benign, risk-factor	Missense variant, non coding transcript variant, intron variant, coding sequence variant
rs750526659	C>G,T	Risk-factor	Coding sequence variant, non coding transcript variant, intron variant, missense variant

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
E2F1	Repression	21225257;22464952
IRF4	Repression	19955181

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	8524823
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	17560375
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	8524823
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	17560375
GO:0002376	Process	Immune system process	IBA	21873635
GO:0003677	Function	DNA binding	NAS	12062447
GO:0005515	Function	Protein binding	IPI	15841462, 16154084, 16362036, 17599067, 17761676, 18309294, 18583960, 18711448, 19153231, 20308324, 20581830, 20628368, 21903422, 21988832, 22908223, 23746807, 24622840, 24807708, 25609812, 25803835, 26347139, 27980081, 29429998, 29802199, 31413131, 32878885
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	17079289, 18818105
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	17079289, 18818105
GO:0005737	Component	Cytoplasm	IGI	23729669
GO:0005739	Component	Mitochondrion	IDA	25609812
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	TAS	20049431
GO:0006974	Process	Cellular response to DNA damage stimulus	TAS	16979567
GO:0016032	Process	Viral process	IEA
GO:0019904	Function	Protein domain specific binding	IPI	11583620
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032479	Process	Regulation of type I interferon production	TAS
GO:0032480	Process	Negative regulation of type I interferon production	TAS
GO:0032481	Process	Positive regulation of type I interferon production	IDA	25636800
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032727	Process	Positive regulation of interferon-alpha production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	TAS	16979567
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IDA	25636800
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0039530	Process	MDA-5 signaling pathway	TAS	16979567
GO:0042802	Function	Identical protein binding	IPI	15841462, 16301520, 18725644, 19416887, 19454348, 20403326, 20581830, 21102435, 21782231, 22000020, 22728658, 23746807, 25609649
GO:0042803	Function	Protein homodimerization activity	IDA	22394562
GO:0042803	Function	Protein homodimerization activity	IPI	12062447
GO:0042981	Process	Regulation of apoptotic process	IDA	25609812
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8524823, 9660935
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17560375
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051607	Process	Defense response to virus	ISS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0071360	Process	Cellular response to exogenous dsRNA	IEA
GO:0071888	Process	Macrophage apoptotic process	TAS	16846591
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0098586	Process	Cellular response to virus	IDA	25609812
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
603734	6118	ENSG00000126456

Protein

UniProt ID

Q14653

Protein name

Interferon regulatory factor 3 (IRF-3)

Protein function

Key transcriptional regulator of type I interferon (IFN)-dependent immune responses which plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:22394562, PubMed:24049179, PubMed:25636800, PubMed:27302953, PubMed

PDB

1J2F , 1QWT , 1T2K , 1ZOQ , 2O61 , 2O6G , 2PI0 , 3A77 , 3QU6 , 5JEJ , 5JEK , 5JEL , 5JEM , 5JEO , 5JER , 6SIV , 6SJA , 7JFL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	7 → 110	Interferon regulatory factor transcription factor	Domain
PF10401	IRF-3	201 → 380	Interferon-regulatory factor 3	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed constitutively in a variety of tissues. {ECO:0000269|PubMed:8524823}.

Sequence

MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES

Sequence length

427

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Vitiligo	Vitiligo	GWAS
Schizophrenia	Schizophrenia	GWAS

Show/Hide Text Mining Associations (78)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute On Chronic Liver Failure	Associate	26173605
Adenocarcinoma of Lung	Associate	28566697
Alzheimer Disease	Stimulate	30076830
Alzheimer Disease	Associate	39753133
Asthma	Associate	24475887
Atherosclerosis	Associate	20154210
Autoimmune Diseases	Associate	26794091
Biliary Atresia	Associate	29070776
Breast Neoplasms	Associate	31287789
Carcinogenesis	Associate	23449805, 28566697
Carcinoma Hepatocellular	Associate	18781139, 25100852, 32394474
Carcinoma Hepatocellular	Stimulate	33006365
Carcinoma Non Small Cell Lung	Associate	23658645
Carcinoma Pancreatic Ductal	Associate	36905103
CD59 Deficiency	Associate	36030554
Colitis Ulcerative	Associate	36165492
Colonic Diseases	Associate	21859832
Colonic Neoplasms	Associate	33161410
Colorectal Neoplasms	Associate	21859832, 25350395, 31869529
Colorectal Neoplasms	Stimulate	34488791
COVID 19	Associate	24622840, 27094905, 32783921, 33413449, 33440148, 34193364, 35842705, 37217661
COVID 19	Stimulate	36107502
Dermatomyositis	Associate	36030554
Diabetes Mellitus	Associate	28698384
Diabetes Mellitus Type 2	Associate	20067962, 36552771
Drug Related Side Effects and Adverse Reactions	Associate	37986544
Encephalitis Herpes Simplex	Associate	21722947, 26216125
Endometrial Neoplasms	Associate	35993041
Endometriosis	Associate	36509095
Gingivitis	Associate	31448244
Glucosephosphate Dehydrogenase Deficiency	Associate	37335045
Hereditary leiomyomatosis and renal cell cancer	Associate	24942949
Hidradenitis Suppurativa	Associate	38011564
HIV Infections	Inhibit	32053234
HTLV I Infections	Inhibit	19706707
Hypoxia	Inhibit	34108245
Infections	Associate	17804510, 19515829, 23027953, 23658645, 31673117, 31785031, 35248104
Infections	Stimulate	20130065
Inflammation	Associate	15215253, 17393359, 19646728, 20728939, 24936783, 25658875, 30936263, 31068249, 32047494, 32413959, 34214498, 35631163, 38011564
Inflammation	Inhibit	22170100
Influenza Human	Associate	16014923
Leukemia Lymphocytic Chronic B Cell	Associate	27611921
Lung Neoplasms	Associate	28566697
Lupus Erythematosus Systemic	Associate	25130328, 40131776
Lymphoma	Inhibit	17393359
Lymphoma Follicular	Associate	17393359
Lymphoma Primary Effusion	Associate	17890449, 21345951, 31666375, 32843547
Mucocutaneous Lymph Node Syndrome	Associate	34193364
Multiple Sclerosis	Associate	22170100, 40131776
Neonatal herpes	Associate	26216125
Neoplasms	Associate	20698843, 23449805, 24248600, 24752990, 33479394, 34488791, 36061145, 37335045, 37926963
Neoplasms	Stimulate	33902005
Nephrosis congenital	Associate	26123900
Neuroblastoma	Associate	17156435
Neurodegenerative Diseases	Associate	32413959
Neuroinflammatory Diseases	Inhibit	22170100
Obesity	Associate	32188105
Obesity	Inhibit	36851534
Osteosarcoma	Associate	35662245
Pancreatic Neoplasms	Associate	35012444
Paramyxoviridae Infections	Associate	19922606
Platelet Factor 3 Deficiency	Associate	26216125
Platelet Factor 3 Deficiency	Inhibit	26216125
Prostatic Neoplasms	Associate	23657238, 32894795, 38057852, 38376283
Pruritus	Associate	33766508
Rectal Neoplasms	Associate	21859832
Respiratory Distress Syndrome	Associate	19635508
Severe Acute Respiratory Syndrome	Associate	19635508
Sexually Transmitted Diseases	Associate	32894795
Sezary Syndrome	Associate	20698843
Stomach Neoplasms	Associate	20507321, 37328804
Tuberculosis Spinal	Associate	39232642
Uterine Cervical Dysplasia	Associate	19012493
Uterine Cervical Neoplasms	Associate	19012493
Vascular Diseases	Associate	20154210
Virus Diseases	Associate	10585427, 10662616, 11035028, 12388374, 17035306, 20698843, 20980500, 24760149, 28566697, 34166398, 34203706
Virus Diseases	Stimulate	17142768
Zika Virus Infection	Associate	36851534

IRF3 (interferon regulatory factor 3)