Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3569
Gene name	Interleukin 6
Gene symbol	IL6
Synonyms (NCBI Gene)	BSF-2BSF2CDFHGFHSFIFN-beta-2IFNB2IL-6
Chromosome	7
Chromosome location	7p15.3
Summary	This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005420	hsa-let-7a-5p	Luciferase reporter assayqRT-PCRWestern blot	19878981
MIRT006061	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006061	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006061	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006790	hsa-miR-142-3p	ELISAImmunoblotMicroarrayqRT-PCR	21474672
MIRT007374	hsa-miR-26a-5p	Luciferase reporter assay	23389848
MIRT016026	hsa-miR-939-5p	Other	21611196
MIRT016949	hsa-miR-335-5p	Microarray	18185580
MIRT020073	hsa-miR-365a-3p	Reporter assay	21518763
MIRT021049	hsa-miR-155-5p	Proteomics	20584899
MIRT021049	hsa-miR-155-5p	Proteomics	18668040
MIRT022183	hsa-miR-124-3p	Microarray	18668037
MIRT023501	hsa-miR-1-3p	Microarray	18668037
MIRT027449	hsa-miR-98-5p	Microarray	19088304
MIRT054777	hsa-miR-107	Luciferase reporter assayqRT-PCRWestern blotCoimmunoprecipitationChromatin immunoprecipitationImmunofluorescence microscopy	24429361
MIRT438344	hsa-miR-149-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	25916550
MIRT438284	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438050	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRELISA	23977098
MIRT438050	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRELISA	23977098
MIRT438344	hsa-miR-149-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	25916550
MIRT438284	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438050	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRELISA	23977098
MIRT438050	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRELISA	23977098
MIRT733359	hsa-miR-146a-5p	MicroarrayLuciferase reporter assay	25265569
MIRT731223	hsa-let-7f-5p	ELISALuciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISALuciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISALuciferase reporter assay	26810534
MIRT731223	hsa-let-7f-5p	ELISALuciferase reporter assay	26810534
MIRT731232	hsa-miR-146b-5p	Luciferase reporter assayqRT-PCRWestern blot	26338965
MIRT731232	hsa-miR-146b-5p	Luciferase reporter assayqRT-PCRWestern blot	26338965
MIRT027449	hsa-miR-98-5p	Luciferase reporter assayqRT-PCRWestern blot	26367177
MIRT731346	hsa-miR-9-5p	Luciferase reporter assay	25809226
MIRT731346	hsa-miR-9-5p	Luciferase reporter assay	25809226
MIRT027449	hsa-miR-98-5p	Luciferase reporter assayqRT-PCRWestern blot	26587789
MIRT027449	hsa-miR-98-5p	Luciferase reporter assayqRT-PCRWestern blot	26587789
MIRT733041	hsa-miR-375	ELISAqRT-PCRWestern blotting	33938607
MIRT733359	hsa-miR-146a-5p	ELISAImmunoprecipitaion (IP)qRT-PCR	34203452
MIRT007374	hsa-miR-26a-5p	ELISAImmunoprecipitaion (IP)qRT-PCR	34203452
MIRT733361	hsa-miR-26b-5p	ELISAImmunoprecipitaion (IP)qRT-PCR	34203452
MIRT020073	hsa-miR-365a-3p	ELISAImmunoprecipitaion (IP)qRT-PCR	34203452
MIRT733563	hsa-miR-603	Immunocytochemistry (ICC)Western blotting	34056002
MIRT734350	hsa-miR-29b-3p	qRT-PCR	31495191
MIRT734353	hsa-miR-199a-3p	qRT-PCR	31495191
MIRT027449	hsa-miR-98-5p	Luciferase reporter assayWestern blottingqRT-PCRELISA	31886314
MIRT022105	hsa-miR-125b-5p	Microarray	33429366
MIRT735301	hsa-miR-298	Luciferase reporter assayqRT-PCRELISA	32353008
MIRT735664	hsa-miR-340-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	32712318
MIRT735795	hsa-miR-137	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32498294
MIRT438050	hsa-let-7c-5p	qRT-PCR	34198264
MIRT438344	hsa-miR-149-5p	qRT-PCR	34198264
MIRT438050	hsa-let-7c-5p	Western blottingMicroarrayELISA	31915680
MIRT731346	hsa-miR-9-5p	qRT-PCR	31578247
MIRT737372	hsa-miR-19a-3p	MicroarrayqRT-PCR	32308549
MIRT438284	hsa-miR-223-3p	RNA-seqqRT-PCRFlow cytometry	32493731
MIRT737573	hsa-miR-146a-3p	RNA-seqqRT-PCRELISA	31700158
MIRT755511	miR-374c-5p	Western blottingqRT-PCRELISA	35689099
MIRT755511	miR-374c-5p	Western blottingqRT-PCRELISA	35689099
MIRT005420	hsa-let-7a-5p	Luciferase reporter assayWestern blottingqRT-PCR	36215225
MIRT438050	hsa-let-7c-5p	Luciferase reporter assay	34967707
MIRT1550127	hsa-miR-149	CLIP-seq
MIRT1550128	hsa-miR-3064-5p	CLIP-seq
MIRT1550129	hsa-miR-3126-3p	CLIP-seq
MIRT1550130	hsa-miR-4766-5p	CLIP-seq
MIRT1550131	hsa-miR-4794	CLIP-seq
MIRT1550132	hsa-miR-760	CLIP-seq
MIRT2015481	hsa-miR-136	CLIP-seq
MIRT2015482	hsa-miR-3123	CLIP-seq
MIRT2015483	hsa-miR-3925-5p	CLIP-seq
MIRT2015484	hsa-miR-3976	CLIP-seq
MIRT2015485	hsa-miR-4803	CLIP-seq
MIRT2015486	hsa-miR-515-5p	CLIP-seq
MIRT2015481	hsa-miR-136	CLIP-seq
MIRT2015482	hsa-miR-3123	CLIP-seq
MIRT2015483	hsa-miR-3925-5p	CLIP-seq
MIRT2015484	hsa-miR-3976	CLIP-seq
MIRT2015485	hsa-miR-4803	CLIP-seq
MIRT2015486	hsa-miR-515-5p	CLIP-seq
MIRT2551397	hsa-miR-103b	CLIP-seq
MIRT2551398	hsa-miR-1297	CLIP-seq
MIRT2551399	hsa-miR-1323	CLIP-seq
MIRT2551400	hsa-miR-153	CLIP-seq
MIRT2551401	hsa-miR-217	CLIP-seq
MIRT2551402	hsa-miR-23a	CLIP-seq
MIRT2551403	hsa-miR-23b	CLIP-seq
MIRT2551404	hsa-miR-23c	CLIP-seq
MIRT2551405	hsa-miR-26a	CLIP-seq
MIRT2551406	hsa-miR-26b	CLIP-seq
MIRT2551407	hsa-miR-3129-3p	CLIP-seq
MIRT2551408	hsa-miR-3163	CLIP-seq
MIRT2551409	hsa-miR-3662	CLIP-seq
MIRT2551410	hsa-miR-374c	CLIP-seq
MIRT2551411	hsa-miR-4272	CLIP-seq
MIRT2551412	hsa-miR-4465	CLIP-seq
MIRT2551413	hsa-miR-4795-3p	CLIP-seq
MIRT2551414	hsa-miR-494	CLIP-seq
MIRT2551415	hsa-miR-498	CLIP-seq
MIRT2551416	hsa-miR-548o	CLIP-seq
MIRT2551417	hsa-miR-587	CLIP-seq
MIRT2551418	hsa-miR-607	CLIP-seq
MIRT2551419	hsa-miR-655	CLIP-seq
MIRT2551420	hsa-miR-885-5p	CLIP-seq
MIRT2551397	hsa-miR-103b	CLIP-seq
MIRT2551400	hsa-miR-153	CLIP-seq
MIRT2551401	hsa-miR-217	CLIP-seq
MIRT2551411	hsa-miR-4272	CLIP-seq
MIRT2551414	hsa-miR-494	CLIP-seq
MIRT2551417	hsa-miR-587	CLIP-seq
MIRT2551420	hsa-miR-885-5p	CLIP-seq

Show/Hide all (40)

Transcription factor	Regulation	Reference
AHR	Activation	20511231
AHR	Unknown	18483242;23349129
ATF4	Unknown	16931790
CEBPA	Unknown	11975924
CEBPB	Activation	10903137;8725624
CEBPB	Unknown	11120852
CREB1	Activation	8725624
DDIT3	Activation	12706815
EGR1	Repression	15517885
EGR2	Unknown	24007274
EP300	Unknown	19966855
FOXO1	Activation	21185807
GBX2	Activation	10690529
JUN	Activation	20225236
JUN	Unknown	10542237;11120852
JUND	Activation	11337499
KLF4	Activation	23846700
MYC	Unknown	19259613
NFKB1	Activation	10329846;10903137;11327783;11504280;12058956;12887736;14532843;15756023;16984731;17040605;17196927;18057724;18061164;18243142;18942706;18996370;19124729;19164127;20066113;22547075;7876168;8679226;8725624
NFKB1	Repression	15517885
NFKB1	Unknown	10823821;10963848;11120852;11975924;15158360;16112536;17490702;17532054;19469019;19707556;2405250;8752656;9516466
OTX2	Activation	21047732
PPARA	Unknown	15001458
RBPJ	Activation	10329846
RBPJ	Unknown	9516466
REL	Repression	1372388
RELA	Activation	10329846;10903137;11327783;11504280;12058956;12887736;14532843;15756023;16984731;17040605;17196927;18057724;18061164;18243142;18942706;18996370;19124729;19164127;20066113;22547075;7499267;7876168;8679226
RELA	Repression	15517885
RELA	Unknown	10542237;10823821;10963848;11120852;11975924;15158360;16112536;17490702;17532054;19469019;19707556;19966855;20457835;8752656;9516466
SP1	Activation	18502099
STAT1	Repression	18616672
STAT3	Activation	10391682;18765795;20930550;22547075;22927445
STAT3	Repression	18616672
STAT3	Unknown	22105366;22363173
TBP	Repression	9209275
VDR	Repression	11050002
XBP1	Unknown	16931790
ZFP36	Repression	21656745
ZMYND11	Activation	19379743
ZNF300	Activation	21777376

143

Show/Hide all (143)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001781	Process	Neutrophil apoptotic process	IDA	7595060
GO:0002314	Process	Germinal center B cell differentiation	ISS
GO:0002384	Process	Hepatic immune response	IDA	2444978
GO:0002384	Process	Hepatic immune response	TAS	12832423
GO:0002446	Process	Neutrophil mediated immunity	TAS	16034137
GO:0002548	Process	Monocyte chemotaxis	IC	10510402
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	3491322
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0002675	Process	Positive regulation of acute inflammatory response	IDA	2444978
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	TAS	16034137
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	3023045, 3491322, 12829785, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005125	Function	Cytokine activity	NAS	10443688
GO:0005125	Function	Cytokine activity	TAS	28720735
GO:0005138	Function	Interleukin-6 receptor binding	IEA
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005138	Function	Interleukin-6 receptor binding	NAS	1883960
GO:0005138	Function	Interleukin-6 receptor binding	TAS	10925276
GO:0005515	Function	Protein binding	IPI	8702737, 11238858, 12829785, 18775332, 25401472, 28265003
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11080265, 27830702
GO:0005615	Component	Extracellular space	IDA	3023045, 10443688, 16034137
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005896	Component	Interleukin-6 receptor complex	IDA	2261637, 12829785
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	12832423
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10443688
GO:0006954	Process	Inflammatory response	TAS	28720735
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IC	3491322
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IMP	28433754
GO:0008083	Function	Growth factor activity	IDA	2261637, 12643274
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2829354
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2261637, 31886314
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	25809226
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18719127
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	3023045
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010574	Process	Regulation of vascular endothelial growth factor production	IDA	8557680
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	28433754
GO:0010628	Process	Positive regulation of gene expression	IDA	27252421
GO:0010628	Process	Positive regulation of gene expression	IGI	31886314
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	25916550
GO:0010888	Process	Negative regulation of lipid storage	NAS	16464856
GO:0014823	Process	Response to activity	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	2261637, 12643274
GO:0030154	Process	Cell differentiation	IEA
GO:0030168	Process	Platelet activation	TAS	7831669
GO:0031018	Process	Endocrine pancreas development	ISS
GO:0031175	Process	Neuron projection development	IMP	3264880
GO:0032494	Process	Response to peptidoglycan	NAS	16034137
GO:0032682	Process	Negative regulation of chemokine production	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	10510402
GO:0032722	Process	Positive regulation of chemokine production	NAS	16034137
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	31886314
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	31886314
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS	25362566
GO:0032745	Process	Positive regulation of interleukin-21 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	10510402
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	31886314
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	31886314
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IDA	12419823
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0035633	Process	Maintenance of blood-brain barrier	TAS	29702085
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	3130269
GO:0042593	Process	Glucose homeostasis	IDA	22037645
GO:0042802	Function	Identical protein binding	IPI	8702737
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9949178
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7595060
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12419823
GO:0045599	Process	Negative regulation of fat cell differentiation	NAS	16464856
GO:0045669	Process	Positive regulation of osteoblast differentiation	TAS	12372336
GO:0045727	Process	Positive regulation of translation	IDA	16732314
GO:0045765	Process	Regulation of angiogenesis	IC	8557680
GO:0045779	Process	Negative regulation of bone resorption	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16606666
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17875732
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7749983, 16946298, 17324931
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IC	17324931
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	12419823, 17324931
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10510402
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050796	Process	Regulation of insulin secretion	IDA	22037645
GO:0050829	Process	Defense response to Gram-negative bacterium	TAS	16034137
GO:0050830	Process	Defense response to Gram-positive bacterium	TAS	16034137
GO:0050871	Process	Positive regulation of B cell activation	IDA	3491322
GO:0051223	Process	Regulation of protein transport	IEA
GO:0051251	Process	Positive regulation of lymphocyte activation	IEA
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0051607	Process	Defense response to virus	IDA	3023045
GO:0060252	Process	Positive regulation of glial cell proliferation	IDA	2104886
GO:0061470	Process	T follicular helper cell differentiation	ISS
GO:0061888	Process	Regulation of astrocyte activation	TAS	29702085
GO:0070050	Process	Neuron cellular homeostasis	TAS	29702085
GO:0070091	Process	Glucagon secretion	ISS
GO:0070092	Process	Regulation of glucagon secretion	IDA	22037645
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IBA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873, 12829785
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	7749983, 11884403, 12552091, 12829785, 16946298, 30670152, 31145836
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	28433754
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	19168699
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	23776175
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IMP	26587789
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097421	Process	Liver regeneration	ISS
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	12552091, 12643274, 19390056
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	31886314
GO:0098586	Process	Cellular response to virus	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	TAS	29702085
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	31886314
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	31145836
GO:1902512	Process	Positive regulation of apoptotic DNA fragmentation	IMP	28433754
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19390056
GO:1903978	Process	Regulation of microglial cell activation	TAS	29702085
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IEA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IGI	30670152
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IDA	30670152
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	ISS
GO:2000635	Process	Negative regulation of primary miRNA processing	IGI	31507089
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	ISS
GO:2000676	Process	Positive regulation of type B pancreatic cell apoptotic process	TAS	18719127

MIM	HGNC	e!Ensembl
147620	6018	ENSG00000136244

P05231

Protein name

Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2)

Protein function

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable).

PDB

1ALU , 1IL6 , 1P9M , 2IL6 , 4CNI , 4J4L , 4NI7 , 4NI9 , 4O9H , 4ZS7 , 5FUC , 7NXZ , 8D82 , 8QY5 , 8QY6 , 8YWQ , 8YWR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00489	IL6	27 → 212	Interleukin-6/G-CSF/MGF family	Domain

Tissue specificity

TISSUE SPECIFICITY: Produced by skeletal muscle. {ECO:0000269|PubMed:11080265}.

Sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Sequence length

212

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	other; risk factor	rs1800795	RCV003311660
Crohn disease-associated growth failure, susceptibility to	other; risk factor	rs1800795	RCV000015837
Diabetes mellitus type 2, susceptibility to	other; risk factor	rs1800795	RCV001281346
Diabetes mellitus, type 1, susceptibility to	other; risk factor	rs1800795	RCV002264639
IL6 POLYMORPHISM	Benign	rs1800797	RCV000015839
IL6-related disorder	Benign	rs2069849, rs142759801	RCV003972268 RCV003930512
Kaposi sarcoma	other; risk factor	rs1800795	RCV000015834

Show/Hide Text Mining Associations (1551)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	1616367
Abdominal Pain	Associate	30918467
Abortion Habitual	Associate	24975966, 29017513
Abortion Spontaneous	Inhibit	10632428
Abortion Spontaneous	Associate	35090453, 35955896
Abscess	Associate	37091905
Achalasia Addisonianism Alacrimia syndrome	Associate	17194638
Acidemia isovaleric	Associate	33166496
Acidosis	Associate	40217316
Acne Vulgaris	Associate	25153527, 29771405, 32627753
Acquired Immunodeficiency Syndrome	Associate	1693429, 20507572, 32532356, 7657807, 8815158
Acute Coronary Syndrome	Associate	11714126, 21245598, 24334757, 26304941, 31238711, 33035661
Acute Coronary Syndrome	Stimulate	20061546, 23305094, 24524679, 25591771, 28407320
Acute Disease	Associate	22227623, 24696530, 26559268, 38045696
Acute Disease	Stimulate	31756302
Acute Kidney Injury	Stimulate	23511138, 29238179, 33348065, 33939645
Acute Kidney Injury	Associate	23825078, 25619315, 35491874
Acute Kidney Injury	Inhibit	30973904
Acute Lung Injury	Associate	18950526, 22742663, 23251429, 29176262
Acute On Chronic Liver Failure	Associate	1597519, 24727541, 31628069, 35502507, 36626090
Acute On Chronic Liver Failure	Stimulate	33717119
Adenocarcinoma	Associate	24420154, 29938471, 29991802, 32869704, 33120770, 34245398, 34993731, 38103126, 39334882
Adenocarcinoma	Stimulate	32298379, 33290281, 39337548
Adenocarcinoma of Lung	Associate	10732762, 18167335, 20032397, 21122157, 24789104, 31004093, 31698633, 32434541, 32705271, 33062704, 33120770, 33429366, 33493519, 34480250, 35379924 View all (6 more)
Adenocarcinoma of Lung	Stimulate	24420154
Adenoma	Associate	17579859, 21160427, 24859972, 26516697, 35563601
Adenoma Liver Cell	Associate	21690253, 26516697
Adenoma Pleomorphic	Associate	27286739
Adenomyosis	Associate	16989825, 28779087, 31576674, 32933042, 35603555
Adenomyosis	Stimulate	37967572
Adrenal Gland Neoplasms	Associate	33316770
Aggressive Periodontitis	Associate	21931203, 26917438, 28099578, 28662328
AIDS Associated Nephropathy	Associate	9507203
AIDS Dementia Complex	Associate	26075907, 9523575
AIDS related Kaposi sarcoma	Associate	1693429
AIDS related Kaposi sarcoma	Stimulate	7657807
Airway Remodeling	Stimulate	27296563
Alcoholism	Associate	21176217
Allergic Fungal Sinusitis	Associate	26266960, 28095898, 29417576, 34356683
Alveolitis Extrinsic Allergic	Associate	19117745
Alzheimer Disease	Associate	15212825, 19698145, 21070631, 21116047, 22272811, 24947882, 26626881, 28943632, 30193587, 30336198, 30611996, 31123752, 31733942, 32474469, 34180415 View all (11 more)
Alzheimer Disease	Stimulate	18637012, 20110602, 29361890, 33803478, 35689551, 35697992, 37679689, 38178159, 39684454
Alzheimer Disease	Inhibit	22272811
Amaurosis Fugax	Associate	18307518
Ameloblastoma	Associate	21196890, 36748192
Ameloblastoma	Stimulate	31901915
Amniotic Band Syndrome	Stimulate	31693497
Amyloid Neuropathies Familial	Stimulate	28484271
Amyloidosis	Associate	1616367
Amyotrophic Lateral Sclerosis	Associate	26198021, 26212797, 32924606
Amyotrophic Lateral Sclerosis	Stimulate	29246232, 31611269
Anaphylaxis	Associate	30189430
Androgen Insensitivity Syndrome	Stimulate	25860946
Anemia	Stimulate	18547996
Anemia	Associate	20644113, 30047815, 32720970, 39962550
Anemia Aplastic	Associate	18477039
Anemia Diamond Blackfan	Associate	12718904, 29745857
Anemia Refractory with Excess of Blasts	Stimulate	25679997
Anemia Sickle Cell	Associate	10641497, 24290434, 25378535, 25548984, 27026283
Aneurysm	Associate	16648144, 17996468, 28434701, 35909487
Aneurysm Ascending Aorta	Associate	31363123, 34202072, 37207221
Aneurysm Ruptured	Associate	19111481
Angina Stable	Stimulate	26075620, 35942210
Angina Stable	Associate	28260995, 28407320
Anhedonia	Associate	34135474, 34502316
Ankle Fractures	Stimulate	29940605, 30237391
Anodontia	Associate	1710152, 32792856
Anodontia	Stimulate	28578351, 39778225
Anophthalmia with pulmonary hypoplasia	Associate	29853638
Anovulation	Associate	12790840
Anterior Cruciate Ligament Injuries	Associate	26762166, 37919719
Anthropophobia	Associate	33936110, 37031355
Anti N Methyl D Aspartate Receptor Encephalitis	Stimulate	30418472, 36544777
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	34220828
Antiphospholipid Syndrome	Associate	25785264
Anxiety	Associate	32769481, 34135474
Anxiety Disorders	Stimulate	36051484
Aortic Aneurysm	Stimulate	28434701
Aortic Aneurysm	Associate	34202072
Aortic Aneurysm Abdominal	Associate	15288631, 16899122, 17321344, 17996468, 26045772, 28735510, 34930827, 35602104, 37737183
Aortic Aneurysm Abdominal	Stimulate	20488324, 31885770
Aortic Aneurysm Familial Abdominal 1	Associate	17996468
Aortic Aneurysm Familial Abdominal 1	Stimulate	26925780
Aortic Aneurysm Thoracic	Associate	29158612, 36555139, 37445606
Aortic Dissection	Associate	31427887
Aortic Valve Insufficiency	Associate	31858570
Aortic Valve Stenosis	Associate	35181609
Aortic Valve Stenosis	Inhibit	39217396
Aphasia	Associate	35259429
Appendiceal Neoplasms	Associate	15273551, 36447423
Appendicitis	Associate	15273551, 26714766, 30918467
Apraxia Ideomotor	Associate	12872350
Arginine Glycine Amidinotransferase Deficiency	Stimulate	19575800
Arrhythmias Cardiac	Associate	26864064
Arteriolosclerosis	Associate	17190908
Arteriovenous Fistula	Associate	35082332
Arthritis	Associate	10747905, 14613283, 17393419, 18759290, 22687048, 33576004, 34539640, 35088674, 35095831
Arthritis Gouty	Associate	35470716
Arthritis Infectious	Associate	20740673, 23971020, 8544415
Arthritis Infectious	Stimulate	39712015
Arthritis Infectious	Inhibit	7858264
Arthritis Juvenile	Associate	11520812, 14613283, 17530721, 19565513, 23543063, 26561546, 26934060, 28012239, 28286780, 33892792, 34257378, 35325069, 37052526, 37454049, 9769329
Arthritis Juvenile	Stimulate	21637346, 34963488
Arthritis Psoriatic	Associate	1550404, 20631726, 27088930, 28790368, 30181004
Arthritis Psoriatic	Stimulate	16728461, 34011674
Arthritis Reactive	Associate	10524675, 35088674
Arthritis Rheumatoid	Associate	10632674, 10688908, 11037876, 11879547, 12296865, 12632414, 12714388, 14730602, 15000862, 15059275, 15188374, 15248214, 15270863, 1531188, 1550404 View all (128 more)
Arthritis Rheumatoid	Stimulate	14680510, 15140777, 15972956, 16728461, 18311795, 1914237, 19248103, 22275154, 22736176, 24288552, 25164131, 25879761, 28114971, 28183329, 28245522 View all (8 more)
Arthritis Rheumatoid	Inhibit	18584044, 29096690, 34290266
Arthrogryposis and ectodermal dysplasia	Associate	38245732
Ascites	Associate	19497133, 20385810, 20860602, 23784932, 26282935, 27825119, 30800122, 31039761, 32928797, 34078919, 34359872
Ascites	Stimulate	28327095, 34887625
Ascites	Inhibit	28410380, 31005045
Asthma	Associate	15295049, 16936245, 17395587, 18215266, 18774390, 18780949, 19503017, 20371397, 20423350, 23944957, 25360780, 25390970, 25697361, 26001777, 26232643 View all (26 more)
Asthma	Stimulate	26546898, 26764119, 32451375, 34112152, 35572500
Astrocytoma	Associate	10349852, 1937574, 3500852, 9003059, 9523575
Astrocytoma	Stimulate	17121800
Asymptomatic Infections	Associate	31772610
Ataxia Telangiectasia	Associate	23564641, 26189429, 26851119, 30586396
Atherosclerosis	Associate	10747905, 11805151, 12217290, 12736161, 15056843, 18069022, 19347053, 19553556, 23484124, 23874021, 24307759, 26071079, 27034587, 27177313, 27430252 View all (19 more)
Atherosclerosis	Stimulate	27941341
Athletic Injuries	Associate	27035221
Atrial Fibrillation	Associate	17094271, 18215601, 19117239, 19569080, 22681487, 22914813, 22924939, 24144036, 24940886, 29800783, 30180182, 32028277, 32223966, 32345003, 34931349
Atrial Fibrillation	Stimulate	19167648, 19169931, 22001292, 29595637
Atrial Premature Complexes	Associate	34664888
Attention Deficit Disorder with Hyperactivity	Associate	38066446
Autism Spectrum Disorder	Associate	22226452, 29178897, 38288647, 39243986
Autism Spectrum Disorder	Stimulate	26418275, 31578139, 32245323
Autistic Disorder	Stimulate	20102735
Autistic Disorder	Associate	32245323, 39243986
Autoimmune Diseases	Associate	16331268, 18490707, 25345743, 26640809, 27629486, 33590853, 35911690, 36453709, 39229261, 7751005, 8343326
Autoimmune Diseases	Stimulate	31809899
Autoimmune Diseases of the Nervous System	Associate	36453709
Axial osteomalacia	Associate	31941549
Axial Spondyloarthritis	Associate	26178906, 30522483
Bacteremia	Associate	33256638, 36566774
Bacterial Infections	Associate	10477399, 20526368, 34925324, 7522641
Bacterial Infections	Stimulate	14987733, 23212542, 25526183, 8500890
Barrett Esophagus	Associate	21148399, 33290281
Behcet Syndrome	Associate	21059493, 26222305, 27222359, 30076035, 31885007, 35455984, 35488313
Behcet Syndrome	Stimulate	24749687, 24984193, 25303043, 33957967
Berylliosis	Associate	12449171
beta Thalassemia	Associate	23905873, 27104679
Biliary Tract Diseases	Associate	15917303
Biliary Tract Neoplasms	Associate	30419338
Bipolar Disorder	Stimulate	22832610, 26257203, 28074937
Bipolar Disorder	Associate	33667413, 37058046, 38484669
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	22864527
Blast Crisis	Associate	1932751
Blister	Stimulate	24462502, 24945093
Blister	Associate	27868136
Blood Coagulation Disorders	Associate	17596140, 20417488, 35180460, 37555786, 8652818
Blood Platelet Disorders	Stimulate	35180460
Blood Platelet Disorders	Associate	36888618
Bone Diseases	Associate	10632674, 15355555, 17129176, 21196890, 21740541, 28677723, 32524367, 33478001, 34795667, 8690800
Bone Diseases	Stimulate	15287939
Bone Diseases Metabolic	Stimulate	12619938
Bone Diseases Metabolic	Associate	15640323, 16009674, 30819183
Bone Marrow Diseases	Associate	19497133
Bone Marrow Diseases	Stimulate	24890946, 32383346
Bone Marrow Failure Disorders	Associate	36809258
Bone Resorption	Associate	11212160, 21467819, 24557363, 25278075, 33478001, 9807705
Brachydactyly Type D	Stimulate	28504607
Brain Death	Stimulate	17430397
Brain Diseases	Associate	24314052, 24382617, 29168181, 36459652
Brain Diseases	Stimulate	9143252
Brain Infarction	Associate	18436879
Brain Injuries	Associate	24903966, 29402769
Brain Injuries	Stimulate	36539847
Brain Injuries Diffuse	Associate	22117975
Brain Injuries Traumatic	Associate	21676422, 23894384, 31417126, 31553988, 40710309
Brain Injuries Traumatic	Stimulate	31173307
Brain Ischemia	Associate	12846758
Brain Neoplasms	Associate	19497133, 30451357, 31123752
Breast Cancer Lymphedema	Associate	38307372
Breast Neoplasms	Inhibit	10408869, 3054878
Breast Neoplasms	Associate	10574257, 10755407, 12201223, 12771987, 14735187, 16464738, 17261184, 17531096, 17594514, 18060036, 18167335, 18239642, 1852008, 18632641, 19435922 View all (100 more)
Breast Neoplasms	Stimulate	19446661, 22178238, 22203932, 23372803, 24568505, 25476497, 31552680, 33517609, 35524373, 37199043
Bronchial Diseases	Associate	24094526
Bronchial Hyperreactivity	Associate	23737648
Bronchiectasis	Associate	10515411, 31503552
Bronchiolitis	Stimulate	36561744
Bronchiolitis Obliterans	Stimulate	22815323
Bronchiolitis Obliterans Syndrome	Inhibit	16573548
Bronchiolitis Obliterans Syndrome	Associate	22006860, 23685278, 34120222
Bronchiolitis Obliterans Syndrome	Stimulate	22815323, 24164971
Bronchopulmonary Dysplasia	Associate	25797206, 37090732
Bronchopulmonary Dysplasia	Stimulate	35460699
Brucellosis	Associate	20404074
Bruton type agammaglobulinemia	Associate	17090647
Burkitt Lymphoma	Associate	25071000, 29078819, 7689148
Burning Mouth Syndrome	Associate	16864905
Bursitis	Associate	21484857, 26191285, 36008780
Cachexia	Stimulate	23200412
Cachexia	Associate	24886605, 33047901, 34502316, 35967380
Calcinosis	Associate	23564641, 40597062
Calcinosis	Stimulate	28134597
Calcinosis Cutis	Associate	10889822, 32621022
Calcinosis Cutis	Inhibit	36371231
Cancer Pain	Associate	35016421
Candidemia	Associate	27376574
Candidiasis	Associate	35319722
Cap Myopathy	Associate	15672864, 17094460
Capillary Leak Syndrome	Associate	36453709
Capillary Malformation Arteriovenous Malformation	Associate	34478890
Carbamoyl Phosphate Synthase I Deficiency Disease	Stimulate	31866771
Carcinogenesis	Associate	17177164, 18167335, 20065508, 20354000, 21690253, 21710491, 23052692, 23185547, 24531714, 24554664, 25213322, 25697898, 28349833, 30249899, 32593213 View all (7 more)
Carcinoma	Inhibit	16412062
Carcinoma	Associate	24907005
Carcinoma Basal Cell	Associate	12445202, 15610530, 28987144, 31342143, 32859764, 9681393
Carcinoma Basal Cell	Stimulate	35552660
Carcinoma Ductal	Stimulate	28791816
Carcinoma Ductal Breast	Associate	18060036, 1852008, 23696929, 2553849, 37975220, 7512730, 8183909
Carcinoma Embryonal	Associate	10480339, 8455626
Carcinoma Endometrioid	Associate	15904949
Carcinoma Hepatocellular	Associate	10076051, 10438468, 11257503, 11331273, 16339299, 16425355, 1879551, 19126646, 21258167, 22471481, 23011405, 23087145, 23305119, 23684136, 24371367 View all (37 more)
Carcinoma Hepatocellular	Stimulate	11773079, 19374779, 33173438, 34435646
Carcinoma in Situ	Associate	10925276
Carcinoma Intraductal Noninfiltrating	Associate	26268945
Carcinoma Large Cell	Stimulate	31366794
Carcinoma Non Small Cell Lung	Associate	15894558, 15894559, 19505916, 24420154, 24907005, 25548514, 25566963, 26439031, 26486080, 26985948, 28148898, 28715437, 28729401, 29118262, 29575809 View all (15 more)
Carcinoma Non Small Cell Lung	Stimulate	29869537, 30604632, 32329850, 33125430
Carcinoma Ovarian Epithelial	Associate	11950960, 16368063, 17617741, 19619321, 20860602, 23889749, 26282935, 27118139, 27825119, 36814597
Carcinoma Pancreatic Ductal	Stimulate	21847358, 22190968, 25827621
Carcinoma Pancreatic Ductal	Associate	24884871, 27167341, 29092903, 32865617, 33893076, 35859428, 36495330, 36881486, 39256468, 39260693, 39273323, 39684873
Carcinoma Pancreatic Ductal	Inhibit	37047307
Carcinoma Papillary	Stimulate	15904949
Carcinoma Renal Cell	Associate	10843457, 10889822, 11849447, 1596939, 16221209, 16428383, 17100773, 17346426, 19679182, 1991509, 22303451, 23578198, 24034344, 26554658, 28328292 View all (24 more)
Carcinoma Renal Cell	Stimulate	18294286, 25679997
Carcinoma Renal Cell	Inhibit	9845545
Carcinoma Small Cell	Inhibit	16412062
Carcinoma Squamous Cell	Associate	16133109, 18310089, 24356192, 26372664, 27169370, 37369480, 9630206
Cardiomyopathies	Associate	10716473, 32515246, 36298704
Cardiomyopathy Dilated	Associate	25827698, 36049813
Cardiomyopathy Dilated	Stimulate	25888309, 34669781
Cardiomyopathy Hypertrophic	Associate	22447464
Cardiovascular Abnormalities	Associate	12846758
Cardiovascular Diseases	Associate	12846758, 17194638, 17596140, 17994165, 18420533, 18974842, 20164544, 21084246, 21814463, 21818333, 23024462, 23968978, 24043651, 24086545, 25492254 View all (15 more)
Cardiovascular Diseases	Stimulate	27992360, 32658258, 40102901
Carotid Artery Diseases	Inhibit	20536609
Carotid Artery Diseases	Associate	33350884, 33376728
Carotid Artery Diseases	Stimulate	36083252
Carotid Stenosis	Associate	25441669, 27001002, 33350884
Carpal Tunnel Syndrome	Associate	1616367
Carrington syndrome	Associate	26490522
Cartilage Diseases	Associate	18205922, 26762166, 31434236, 31981738, 33228785, 33855071, 36799502, 39768138
Castleman Disease	Associate	1632458, 19139722, 1954381, 23372742, 28241173, 32873770, 34246246, 9403701
Castleman Disease	Stimulate	28183278, 9613678
Cataract	Stimulate	25303043, 37694725
Cataract	Associate	33639877, 39959181
Cataract Age Related Nuclear	Stimulate	37694725
Cataract congenital dominant non nuclear	Associate	1415484, 32724277
CD59 Deficiency	Associate	17125598, 18045485, 37257547
Celiac Disease	Associate	21392369, 28928101, 31717494, 34895167, 35216089, 35354862, 36296938, 38040898
Cell Transformation Neoplastic	Associate	18615482, 21258401, 32418990
Central Nervous System Diseases	Stimulate	38178046
Central Nervous System Diseases	Associate	39364412
Central Nervous System Infections	Associate	10377335
Cerebral Hemorrhage	Associate	27730688, 31646585, 35833818, 39433142
Cerebral Hemorrhage	Stimulate	29194369, 38167007
Cerebral Infarction	Associate	20059469, 20622166, 24782217, 25333814, 26722564, 28716248, 28724745, 31192907, 31215220, 32223966, 35856366, 36254030, 37268894
Cerebral Infarction	Stimulate	31481525, 38245621
Cerebral Intraventricular Hemorrhage	Associate	28664278
Cerebral Palsy	Associate	24314052, 24903966
Cerebral Small Vessel Diseases	Associate	32223966
Cerebrospinal Fluid Rhinorrhea	Associate	35627281
Cerebrovascular Disorders	Associate	17519976, 18467705, 23019398, 24165468, 30568999, 30664615
Chanarin Dorfman Syndrome	Stimulate	39307292
Charcot Marie Tooth Disease Foot Deformity of	Associate	30155488
Chemical and Drug Induced Liver Injury	Associate	30600293
Chemotherapy Related Cognitive Impairment	Associate	27701469
Cherubism	Associate	30236129
Chills	Associate	14676800, 14984503
Chlamydial Pneumonia	Stimulate	15557648
Chlamydial Pneumonia	Associate	16499573
Cholangiocarcinoma	Associate	15917303, 17241887, 24998588, 27809873, 30419338, 32505533, 34758510, 34948304, 36317517
Cholangitis Sclerosing	Stimulate	12077104, 34519176
Cholangitis Sclerosing	Associate	17162367, 24390753, 25046437, 35563301, 37256725
Cholera	Stimulate	17697117
Cholestasis	Associate	35196362
Cholesteatoma	Associate	24551293, 33627146
Cholesteatoma Middle Ear	Associate	24551293, 31947538
Chondrosarcoma	Associate	21278254
Chordoma	Associate	34127734, 39393273
Chorioamnionitis	Associate	20693312, 20724602, 25797206, 25938217, 30795743
Chorioamnionitis	Stimulate	22752762
Choriocarcinoma	Associate	8898173
Choroidal Effusions	Associate	33977746
Chromosome Aberrations	Associate	10830783
Chronic Disease	Associate	11520812, 17951471, 20001857, 23472199, 23593036, 27079270, 28077069, 32213162, 32369831, 35964023, 7701874
Chronic Disease	Stimulate	34220309
Chronic Kidney Disease Mineral and Bone Disorder	Associate	25492254
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	33305290
Chronic Limb Threatening Ischemia	Associate	17598820
Chronic Pain	Associate	32213162, 32717400, 39231552
Chronic Periodontitis	Associate	20881337, 23592000, 24670840, 25098998, 25530681, 26096103, 29489938
Chronic Periodontitis	Stimulate	21198766
Chronic Periodontitis	Inhibit	26211001, 30427403
Chronic Urticaria	Associate	38045687
Chronobiology Disorders	Associate	34951048
Ciliary Discoordination Due To Random Ciliary Orientation	Associate	32532356
Ciliary Motility Disorders	Associate	38245732
Ciliopathies	Associate	38245732
Clear cell metastatic renal cell carcinoma	Associate	33759378, 34965953
Cleft Palate	Associate	22174866
Cleft Palate	Stimulate	30688042
Clinical Deterioration	Associate	25989735
Cockayne Syndrome	Associate	9492179
Cognition Disorders	Associate	19359268, 23364322, 23559466, 24997674, 25214388, 25609760, 26517210, 27701469, 30256904, 32514870, 35503943, 36805537, 37108527, 40348638
Cognitive Dysfunction	Associate	23593165, 29196629, 30115946, 37373554
Cognitive Dysfunction	Stimulate	36012652
Coinfection	Stimulate	33819170
Colitis	Associate	36159840, 36466854
Colitis Ulcerative	Stimulate	18160345, 18825772, 22185629, 30369485
Colitis Ulcerative	Associate	21129005, 22539302, 25076849, 31798282, 32022398, 32724277, 32871953, 33409535, 36575020, 37078344, 37445676, 37710023
Colonic Diseases	Inhibit	17694420
Colonic Diseases	Associate	17694420, 24970802
Colonic Neoplasms	Associate	11355696, 18205904, 26673628, 30243096
Colonic Neoplasms	Stimulate	33832346
Colorectal Neoplasms	Associate	10903137, 11920517, 12760309, 15188028, 16937502, 17094421, 17189976, 17579859, 17694420, 18205904, 19177010, 20065508, 20354000, 20823887, 21129206 View all (61 more)
Colorectal Neoplasms	Stimulate	16937502, 26595254, 33582655, 33832346, 37047623
Colorectal Neoplasms	Inhibit	21129206, 35213038
Combined Inflammatory and Immunologic Defect	Associate	2103309
Common Variable Immunodeficiency	Associate	19076825, 19592080, 22454615, 31827477, 34146579, 8485909
Communicable Diseases	Associate	32532356
Communication Disorders	Stimulate	17052299
Communication Disorders	Associate	17908660, 22194589, 23258791, 23411129, 29847542, 32564053
Communication Disorders	Inhibit	9596098
Complement Component 6 Deficiency	Stimulate	33227992
Complex Regional Pain Syndromes	Stimulate	17137491, 24462502
Complex Regional Pain Syndromes	Associate	30871575, 37848097
Congenital disorder of glycosylation type 1A	Associate	35711443
Conjunctival Diseases	Associate	28975281
Conjunctivitis Allergic	Associate	24368924
Contracture	Associate	19214689
Conversion Disorder	Associate	17493190
Corneal Endothelial Cell Loss	Associate	18467705, 38195507
Corneal Injuries	Associate	12714388, 32016117
Corneal Perforation	Associate	12714388, 26670709
Corneal Ulcer	Associate	12714388
Coronary Aneurysm	Associate	12217290, 18753723, 28212870
Coronary Aneurysm	Stimulate	28051250
Coronary Artery Disease	Associate	14566255, 19140875, 20206549, 21245598, 22780915, 23881440, 24363620, 24699044, 24736319, 25299085, 25526459, 25867411, 26191329, 26304941, 26345772 View all (30 more)
Coronary Artery Disease	Stimulate	19551157, 26867220, 30333306, 33731531, 33735200, 38075042
Coronary Disease	Associate	17194638, 21804106, 23375186, 23881440, 25082230, 25683698, 27627640, 29121163, 32215496, 33660877, 33849106, 34861059, 34883250, 35782064, 35866783, 37566005, 40184077 View all (2 more)
Coronary Disease	Stimulate	19814730, 27955950, 36051484
Coronary Disease	Inhibit	39344313
Coronary Restenosis	Stimulate	10862597, 31729103
Coronary Restenosis	Associate	11714126, 35082332
Coronary Vasospasm	Associate	35096275
Coronavirus Infections	Stimulate	28103598, 33046696
Coronavirus Infections	Inhibit	28118607
Coronavirus Infections	Associate	34281182, 38178046
Cough	Associate	35866040, 39465738
COVID 19	Stimulate	32217834, 32501293, 33129099, 33284859, 33475159, 33548798, 33552062, 33578018, 33947753, 34061395, 34245398, 34436630, 34543980, 34635175, 34673905 View all (14 more)
COVID 19	Associate	32293910, 32320677, 32532356, 32619549, 32645391, 32673995, 32698440, 32760206, 32783921, 32816392, 32861275, 32871183, 32920092, 32943497, 32950268 View all (158 more)
COVID 19	Inhibit	38250080, 39339947
Coxa Magna	Associate	34986839
Craniocerebral Trauma	Associate	8610106
Craniopharyngioma	Associate	28487953, 36389809
Craniopharyngioma	Stimulate	28859336
Craniosynostoses	Stimulate	25821554
Creutzfeldt Jakob Disease Sporadic	Associate	24047819
Creutzfeldt Jakob Syndrome	Stimulate	23816234
Critical Illness	Associate	20003352, 20583924, 32709104, 33041191, 33939645
Crohn Disease	Associate	10389698, 18025155, 21228771, 21797848, 24635023, 28190086, 29521042, 31415355, 32724277, 33743589, 34106269, 34629811, 35529850, 38517030
Crohn Disease	Stimulate	18160345, 18825772, 20564534, 21877213, 23950992, 33537747, 9099934
Cross Infection	Associate	11687457
Cryopyrin Associated Periodic Syndromes	Associate	17320940, 24773462
Cushing Syndrome	Associate	30480750, 36316863
Cushing's symphalangism	Associate	25526459
Cyclic neutropenia	Stimulate	39210558
Cystic Fibrosis	Associate	10515411, 12762338, 15640323, 20438838, 20507572, 20936184, 22550062, 25058850, 26022954, 26331676, 29861448, 31428093, 31700158, 31803183, 33924887, 36480571 View all (1 more)
Cystic Fibrosis	Stimulate	22014187, 24098711, 24885494, 34721395
Cystitis	Associate	29207018
Cystitis Interstitial	Associate	24146927, 33848079
Cysts	Associate	21755330, 31778601
Cytokine Release Syndrome	Stimulate	10498591, 16636525, 22275154, 24244577, 25896248, 32842957, 32963156, 33422363, 34359843, 36105799, 36797068, 38097400
Cytokine Release Syndrome	Associate	18467705, 20969744, 27076371, 30988175, 32271462, 32669372, 34033999, 35049413, 36220879, 38546698, 39328408
Cytokine Release Syndrome	Inhibit	36977992
Cytomegalovirus Infections	Stimulate	17680510, 22486303, 29527205
Cytomegalovirus Infections	Associate	32532356
Death	Stimulate	17698689, 18235144, 20404020, 24141626, 26768248, 28017325, 34678611, 37844090
Death	Associate	22113576, 22955109, 23185547, 24043651, 25422398, 26463449, 30941129, 32532356, 32633594, 33002623, 33187979, 34285273, 34960725, 36102277, 36429083, 36932108, 37207221, 39182143 View all (3 more)
Delirium	Stimulate	26215633
Delirium	Associate	29529166, 37156856
Deltaretrovirus Infections	Associate	30466392, 9572042
Dementia	Associate	26075907, 26517210
Dementia Vascular	Stimulate	19638714
Demyelinating Diseases	Associate	29518260, 37924373
Dengue	Associate	18272578, 26421267
Dental Leakage	Stimulate	32124729
Dental Plaque	Stimulate	23273713
Dental Plaque	Associate	24925270, 28400572, 33350884
Depressive Disorder	Associate	19073752, 19249913, 23512358, 24726621, 25464926, 25976322, 26945673, 27822318, 29936334, 30886334, 30957546, 32998701, 33079133, 35964023, 36168941, 37745719, 39760673, 39863282, 7858264 View all (4 more)
Depressive Disorder	Stimulate	20836906, 24143878, 24182629, 25683698, 26403459, 27414954, 33903586, 37058046
Depressive Disorder Major	Stimulate	21831269, 24424390, 25022969, 27138824
Depressive Disorder Major	Associate	26804030, 35964023, 37058046
Depressive Disorder Treatment Resistant	Associate	29103192
Depressive Disorder Treatment Resistant	Stimulate	37572636
Dermatitis Atopic	Associate	17960185, 22533231, 22968402, 23654074, 25270893, 27077833, 31596431, 31868801, 34070943, 36587063, 8082305
Dermatitis Atopic	Stimulate	34678092
Dermatitis Atopic 1	Associate	23654074, 31251775
Dermatitis Atopic 1	Stimulate	34916261
Dermatitis Contact	Associate	37187734
Dermatomyositis	Associate	19877033, 24082909, 27803134, 36197661
Dermatomyositis	Stimulate	24288551, 37985458
Desmoplastic Small Round Cell Tumor	Associate	23058034
Developmental Disabilities	Inhibit	19211157
Developmental Dysplasia of the Hip	Associate	28860542, 34203285
Diabetes Gestational	Associate	24397394, 28353315, 28846666, 32280713, 36849131
Diabetes Gestational	Stimulate	33019392, 35390031, 36499008
Diabetes Insipidus Neurogenic	Associate	24055514
Diabetes Mellitus	Associate	11961304, 15180970, 16464741, 16864906, 16988089, 17994165, 20526368, 21149504, 21784542, 21818333, 23160722, 24782217, 25526459, 26911440, 27629486 View all (12 more)
Diabetes Mellitus	Stimulate	17911088, 18285554, 18349110, 20377994, 20682019, 21694775, 22385239, 26517838, 31244210, 32265833, 34283808, 34417262, 34831154, 34951048
Diabetes Mellitus	Inhibit	39456722
Diabetes Mellitus Insulin Dependent 19	Associate	33727573
Diabetes Mellitus Type 1	Associate	12410803, 1592439, 16464741, 16864906, 18045485, 20686866, 23593036, 24523574, 27629486, 33767783, 35693790, 36282595, 36766809
Diabetes Mellitus Type 1	Inhibit	16566827, 31299986, 31809899
Diabetes Mellitus Type 1	Stimulate	19127455, 32221364, 34682638
Diabetes Mellitus Type 2	Associate	15774022, 16443741, 16988089, 18496509, 18650368, 20164544, 20377994, 20967696, 22012292, 22761857, 23110196, 24473436, 25098998, 25222779, 25726203 View all (22 more)
Diabetes Mellitus Type 2	Stimulate	23283045, 23484124, 24182629, 26246197, 26918832, 27904654, 29233142, 31077210, 34079246, 34682638, 34763485, 34917685, 35605453, 35801423, 36232497, 36463286 View all (1 more)
Diabetes Mellitus Type 2	Inhibit	35954211
Diabetic Foot	Stimulate	33096729, 34293021
Diabetic Foot	Associate	35394091, 35909542, 37577369
Diabetic Ketoacidosis	Associate	24619879
Diabetic Nephropathies	Associate	18496509, 18670406, 29999450, 33858824, 34219868, 36363561
Diabetic Nephropathies	Stimulate	24786705, 32723296
Diabetic Neuropathies	Associate	37197158
Diabetic Retinopathy	Stimulate	33328159
Diabetic Retinopathy	Associate	33383381, 36766809, 38222451
Diarrhea	Inhibit	18684212
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	37895018
Diastrophic dysplasia	Stimulate	30273982
DiGeorge Syndrome	Associate	23353117
Disease	Associate	12165085, 12217290, 22235998, 22532634, 23593165, 31809599
Disease	Stimulate	25198673, 40065254
Disease Progression	Associate	32479111, 33545757
Disease Resistance	Associate	37260062
Disruptive Impulse Control and Conduct Disorders	Associate	32710539
Dissociative Disorders	Associate	23951008
Dizziness	Associate	33840589
Down Syndrome	Associate	25222269, 28829905, 29093484, 30186038, 33206953
Drug Eruptions	Associate	34157151
Drug Hypersensitivity	Stimulate	19220829, 35123074
Drug Hypersensitivity	Associate	19657353, 29410184, 31251775, 32476816, 39202464, 7542574, 7579337
Drug Hypersensitivity Syndrome	Associate	34789453
Drug Related Side Effects and Adverse Reactions	Associate	1317349, 16475708, 24048704, 2680182, 27694691, 29091763, 32028672, 37052526, 7538815
Drug Resistant Epilepsy	Stimulate	21315622
Drug Resistant Epilepsy	Associate	27861825, 37653422
Dry Eye Syndromes	Stimulate	23169882, 28379971, 29673232, 32476816
Dry Eye Syndromes	Associate	28887117
Duodenal Ulcer	Associate	15627645
Dysentery Bacillary	Associate	7622234
Dyskeratosis Congenita	Associate	37717172
Dyskinesias	Stimulate	30249899
Dyslipidemias	Associate	17994165, 18420533, 26781506, 28212870, 35274685, 36157437, 40428368
Dyspnea	Associate	33840589
Eales disease	Associate	22025890, 34993731
Eclampsia	Stimulate	22958187
Ectodermal Dysplasia	Associate	35341013
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	19860911
Eczema	Associate	31868801
Edema	Associate	31408438, 34439789, 35488725
Elejalde Disease	Associate	35455984
Embolic Stroke	Associate	32223966
Embolism Air	Associate	24945146, 26911440
Embolism Amniotic Fluid	Associate	25938217
Embolism Fat	Associate	23423626
Emergence Delirium	Associate	32988381
Emphysema	Associate	29065892, 33936110
Encephalitis	Associate	26166120
Encephalitis Tick Borne	Associate	24223711
Encephalitis Tick Borne	Stimulate	37261350
Encephalocele	Associate	20222111, 27807886
Encephalomyelitis Acute Disseminated	Stimulate	33597947
Endocarditis	Associate	16428777, 25299518
Endocarditis	Stimulate	26225421
Endometrial Neoplasms	Associate	15904949, 17953945, 19432902, 22944067, 27193105, 30828987, 31299894
Endometriosis	Associate	10685516, 10785230, 12372470, 12620489, 16759923, 17548071, 17953945, 21640344, 26872033, 27614631, 28300844, 28779573, 29771400, 30276219, 32432788 View all (7 more)
Endometriosis	Stimulate	34360900, 34920657
Endophthalmitis	Stimulate	27293374, 30296277
Endotoxemia	Stimulate	19794059, 22709547
Endotoxemia	Associate	35933445
Endplate Acetylcholinesterase Deficiency	Associate	29529124
Enterocolitis	Stimulate	33891982
Enterocolitis Necrotizing	Stimulate	22606320, 23472217, 24194940, 24732104, 34418984
Enterocolitis Necrotizing	Associate	26670709, 28658176, 33932136, 36371157
Enterovirus Infections	Associate	26252639, 34993731
Eosinophilia	Associate	37052526
Eosinophilic enteropathy	Associate	37661445
Eosinophilic Esophagitis	Associate	21211656, 36591238, 37967572
Ependymoma	Associate	25968456, 28510691
Epidermolysis Bullosa Dystrophica	Stimulate	37161592
Epidermolysis Bullosa Simplex	Stimulate	34536484
Epilepsy	Associate	25366750, 31948324, 32219137, 35091307, 37946105
Epilepsy Post Traumatic	Associate	22773460, 37919719
Epilepsy Temporal Lobe	Associate	37946105
Epilepsy Tonic Clonic	Inhibit	37081485
Epileptic encephalopathy Lennox Gastaut type	Inhibit	20656013
Epiretinal Membrane	Associate	32542038
Epstein Barr Virus Infections	Stimulate	1318324, 16611410, 24696473
Epstein Barr Virus Infections	Associate	15154666, 32273550, 35341013, 36675141, 8298133
Erdheim Chester Disease	Associate	17133532
Erectile Dysfunction	Stimulate	29233142
Erectile Dysfunction	Associate	39809170
Erosive Adenomatosis of the Nipple	Stimulate	26722442
Erysipelas	Associate	28512644
Erythema Nodosum	Associate	10564558
Erythema Nodosum	Stimulate	27474073
Esophageal Neoplasms	Associate	10408408, 23082063, 26761210, 27331408, 35071597, 35780460
Esophageal Neoplasms	Stimulate	25144454
Esophageal Squamous Cell Carcinoma	Associate	10408408, 26761210, 30683902, 32524362, 32825936, 34520294, 35463992, 38619620
Esophagitis	Stimulate	30249899, 33941087
Essential Hypertension	Associate	22924939, 31772610
Essential Hypertension	Stimulate	26617860
Exfoliation Syndrome	Associate	33914756
Exophthalmos	Stimulate	29131274
Fabry Disease	Stimulate	34287477, 38304433
Failed Back Surgery Syndrome	Associate	35964023
Fallopian Tube Diseases	Associate	12496205, 9866071
Fallopian Tube Diseases	Stimulate	33092547
Fallopian Tube Neoplasms	Associate	7926016
Familial Primary Pulmonary Hypertension	Associate	25003325, 32029443
Familial Primary Pulmonary Hypertension	Stimulate	34445297
Fanconi Anemia	Associate	8118026
Fasciitis Necrotizing	Associate	11093140
Fatigue	Associate	11121150, 20570482, 20656013, 22251605, 22475653, 23530106, 25469832, 25976322, 26515035
Fatigue	Stimulate	39578766
Fatigue Syndrome Chronic	Associate	22973830, 25464926, 35570777, 9201656
Fatigue Syndrome Chronic	Inhibit	25836975
Fatty Liver	Associate	25474087, 27730688, 36096296, 39766906
Fatty Liver Alcoholic	Stimulate	25474087
Fatty Liver Alcoholic	Associate	27730688, 31941930
Fetal Death	Associate	30517142, 37569597
Fetal Growth Retardation	Associate	26158499, 39618207
fetal inflammatory response syndrome	Associate	20059468, 23905683, 24659848
Fever	Stimulate	12439605
Fever	Associate	14613283, 19608676, 20583924, 22022504, 2212010, 23737648, 24082909, 24094526, 27434276, 30696839, 31408438, 35371275, 35488725, 7537110, 7538815, 7605999, 9769329 View all (2 more)
Fibrocartilaginous embolism	Associate	33336720, 34321087, 36077518
Fibromyalgia	Inhibit	35455956
Fibrosarcoma	Associate	7537214
Fibrosis	Associate	17125598, 18256065, 21526159, 23592411, 27321784, 27730688, 28349784, 29263305, 29436483, 32345003, 32914376, 33336720, 33465050, 33922041, 34813621, 36077175, 37874141, 37928515, 7752583 View all (4 more)
Fibrosis	Stimulate	19374779, 24757288, 38015590
Fibrosis	Inhibit	29752408, 31822557
Fibrous Dysplasia of Bone	Associate	10404010, 36958543, 8690800
Fibrous Dysplasia Polyostotic	Associate	36958543, 8690800
Focal Cortical Dysplasia	Stimulate	29162878
Food Hypersensitivity	Stimulate	20825428
Fractures Bone	Associate	15355555, 36749277, 37038178
Fractures Spontaneous	Associate	22914813
Fragile X Syndrome	Associate	20102735, 24942544
Frailty	Associate	25989735, 27310835
Frailty	Stimulate	26258797, 28225718
Fraser Syndrome	Associate	8898173
Frontotemporal Dementia	Associate	36890594
Frontotemporal Lobar Degeneration	Associate	25435337
Fuchs' Endothelial Dystrophy	Associate	18603066, 29787599
Fuchs' Endothelial Dystrophy	Stimulate	32636303
Galactosemias	Stimulate	24398680
Gallbladder Neoplasms	Associate	30249899
Gangrene	Associate	15273551
Gardner Syndrome	Associate	33682749
Gastritis	Stimulate	27196487
Gastritis	Associate	34008757, 38366919
Gastritis Atrophic	Inhibit	32947843
Gastritis Atrophic	Associate	34104107, 35905420, 39259113
Gastro enteropancreatic neuroendocrine tumor	Associate	32156252
Gastroesophageal Reflux	Associate	19074641, 27055018, 34438042
Gaucher Disease	Associate	10400826, 25978039, 6693432
Gaucher Disease	Stimulate	26486234
Genital Neoplasms Female	Associate	16803517
Geographic Atrophy	Associate	18538409
Gerstmann Syndrome	Associate	17618104
Giant Cell Arteritis	Associate	24158630, 27927642, 29731755, 36912345, 37703805, 39817309, 8083354
Giant Cell Arteritis	Stimulate	31162032
Gingival Diseases	Associate	31743516
Gingival Overgrowth	Associate	20430366
Glaucoma	Associate	19401404, 20467456, 26396484
Glaucoma Angle Closure	Inhibit	25811482
Glaucoma Angle Closure	Associate	26748993, 36254076
Glaucoma Open Angle	Inhibit	25811482, 29752408
Glaucoma Open Angle	Associate	26820987, 33216119
Glioblastoma	Associate	11506489, 17224923, 23368093, 24472318, 24474429, 25633526, 26143636, 31791385, 32213162, 32885530, 33652086, 34376733, 34713474, 35802478, 36142158, 38238463, 7856743, 8473012 View all (3 more)
Glioblastoma	Stimulate	27163161
Glioma	Stimulate	11506489, 9888463
Glioma	Associate	22752645, 23525947, 24175805, 24472318, 25342742, 25549333, 25966666, 27287871, 27613828, 27861797, 27903982, 29258522, 33174046, 33371165, 34713474 View all (5 more)
Glomerulonephritis	Stimulate	27225718
Glomerulonephritis	Associate	30808838, 33043579
Glomerulonephritis IGA	Associate	18496506, 24398680, 30029622, 8301931, 8565271
Glomerulonephritis IGA	Stimulate	20484297, 27044423, 39516745, 8268396, 8943482
Glomerulonephritis Membranous	Associate	20954977
Glossitis Benign Migratory	Stimulate	11121150
Glucose Intolerance	Associate	22012292
Glucose Metabolism Disorders	Associate	22012292
Glucosephosphate Dehydrogenase Deficiency	Associate	36078120
Glut1 Deficiency Syndrome	Associate	31733942
Glycogen Storage Disease Type IV	Associate	25227842
Goiter	Associate	29131274
Gonorrhea	Stimulate	12228311
Graft vs Host Disease	Associate	11520812, 20565368, 29142307, 34120222
Graft vs Host Disease	Stimulate	20446793, 23792271
Gram Negative Bacterial Infections	Associate	32996896
Gram Positive Bacterial Infections	Associate	32996896
Granuloma Giant Cell	Associate	22157665
Granulomatosis with Polyangiitis	Stimulate	10364903
Granulomatosis with Polyangiitis	Associate	35039330
Granulomatous Mastitis	Associate	39922144
Granulosa Cell Tumor	Associate	15831279
Granulosa cell tumor of the ovary	Associate	14998856
Graves Disease	Associate	21209948, 21235536, 24086448, 25226272, 2680182, 29752312, 31552761, 9222097
Graves Disease	Stimulate	23092922
Graves Ophthalmopathy	Associate	15497456, 19117935, 20017620, 21209948, 22736938, 23092922, 24086448, 25159204, 25198673, 28278511, 33542676, 34383782
Graves Ophthalmopathy	Stimulate	33498689
Guillain Barre Syndrome	Associate	33751722, 34763483
Haemophilus Infections	Stimulate	11349030
HAIR AN syndrome	Stimulate	18825363, 23110196
Hallucinations	Associate	32710539
Hand Foot and Mouth Disease	Stimulate	24367714, 37725516
Hand Injuries	Associate	28002590
Hashimoto Disease	Associate	17115419, 21235536, 25127106, 31552761, 32662826, 33578562, 33943012
Hashimoto Disease	Stimulate	25412700
Haspeslagh Fryns Muelenaere syndrome	Associate	29164949
Head and Neck Neoplasms	Associate	21104991, 21559372, 21845339, 30642292
Headache	Associate	33559789, 7537110
Healthcare Associated Pneumonia	Associate	23411129
Hearing Loss Bilateral	Associate	31006709
Hearing Loss Sensorineural	Associate	29695657
Heart Defects Congenital	Associate	32519679
Heart Diseases	Associate	11985915, 30804931, 31379862, 31632400, 32221364, 32988848, 34365798, 35022042, 39719586
Heart Diseases	Stimulate	20022263, 27104679
Heart Failure	Associate	11511426, 11985915, 14607202, 18353715, 20019408, 22790687, 26705751, 26864064, 30941129, 31379862, 31632400, 32154187, 32515246, 34456907, 34931349 View all (9 more)
Heart Failure	Stimulate	22615818, 23143795, 24074138, 26771970, 30968846, 34744513
Heart Failure Systolic	Stimulate	36303443
Heart Injuries	Associate	32633594
Heart Valve Diseases	Stimulate	19169931
Heart Valve Diseases	Associate	30804931
Helicobacter Infections	Stimulate	15627645, 26945693, 34008757
Helicobacter Infections	Associate	26151690, 26781506, 28746216
HELLP Syndrome	Stimulate	24612145
Hemangioma capillary infantile	Associate	20872175
Hematologic Diseases	Associate	11432624, 20583924, 33958640, 37970725
Hematologic Neoplasms	Associate	39394593
Hematoma	Associate	28282868, 37038178
Hematoma Subdural Chronic	Associate	32479555
Hemolytic Uremic Syndrome	Stimulate	25174507, 31924826
Hemolytic Uremic Syndrome	Inhibit	33641611
Hemolytic Uremic Syndrome	Associate	9767525
Hemorrhage	Stimulate	32124729
Hepatic Encephalopathy	Associate	21940902, 31038755
Hepatic Encephalopathy	Stimulate	26757951
Hepatic Veno Occlusive Disease	Associate	21330458
Hepatitis Alcoholic	Inhibit	25731872
Hepatitis Autoimmune	Associate	21526159, 27183637, 30600293, 31422415
Hepatitis B	Stimulate	12100148, 25899133
Hepatitis B	Associate	12970895, 19374779, 24371367, 27268603, 32532356, 33506937, 37995395, 7545429
Hepatitis B Chronic	Stimulate	19374779, 35801423
Hepatitis C	Associate	20483710, 32532356
Hepatitis C Chronic	Associate	32532356, 35469194
Hepatitis Chronic	Stimulate	1597519
Hepatitis Viral Human	Associate	1597519
Hepatoblastoma	Associate	8987679
Hepatolenticular Degeneration	Inhibit	40214068
Hereditary Angioedema Type III	Associate	15005841
Hereditary Autoinflammatory Diseases	Associate	21852578, 23432807, 30383538
Hereditary Breast and Ovarian Cancer Syndrome	Associate	33331925, 33462316
Hereditary leiomyomatosis and renal cell cancer	Associate	12100148, 1632458, 1710152, 33720338, 8443970
Hereditary pancreatitis	Associate	35469194
Herpes Simplex	Stimulate	16423052
Herpes Zoster	Stimulate	12562395
Herpes Zoster	Associate	34322810
Hidradenitis Suppurativa	Associate	30528824, 37271319
Hip Fractures	Associate	18925325
Hip Injuries	Associate	15355555
Hippocampal Sclerosis	Associate	29162878
Histiocytoma Malignant Fibrous	Associate	7691245
Histiocytosis with joint contractures and sensorineural deafness	Associate	29041934, 34193201
HIV Infections	Associate	10973452, 11001912, 18573939, 1985116, 20722464, 20963937, 21303360, 23718561, 24086545, 24585897, 24759134, 26518043, 27177313, 27861788, 28143443 View all (13 more)
HIV Infections	Stimulate	23507661, 25198707, 27065342, 27117807, 34630420, 9067516
HIV Seropositivity	Stimulate	30779672
Hodgkin Disease	Associate	11468177, 12100148, 15070705, 15686457, 1632458, 1710152, 17496310, 1951632, 19573080, 20406921, 20963937, 24141626, 28791394, 33720338, 7545429, 8630409 View all (1 more)
HTLV I Infections	Associate	11049991, 7860769
Huntington Disease	Associate	17132891, 27681197
Huntington Disease	Stimulate	27170315, 29944162, 34802797
Hyperaldosteronism	Associate	33316770, 39252231
Hyperandrogenism	Associate	12917504
Hyperbilirubinemia	Stimulate	11432624
Hypercalcemia	Associate	10843457, 2212010, 9618523
Hypercholesterolemia	Associate	25993353
Hypereosinophilic Syndrome	Associate	7683928
Hypergammaglobulinemia	Stimulate	1985116
Hyperglycemia	Stimulate	23484124, 33328159
Hyperglycemia	Associate	27001002, 27294162, 34203452
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	30114628, 36517975
Hyperinsulinism	Stimulate	14532168, 23484124
Hyperlipidemia Familial Combined	Associate	12032168
Hyperlipidemias	Associate	18420533, 39433142
Hyperlipoproteinemia Type II	Associate	16083882
Hyperostosis corticalis deformans juvenilis	Associate	10862799, 8840280
Hyperoxia	Associate	10070569, 10666108
Hyperoxia	Stimulate	31411059
Hyperplasia	Associate	21781173, 28851954
Hyperplasia	Stimulate	27342408
Hypersensitivity Delayed	Associate	1458689, 20417488, 34789453
Hypertension	Associate	12846758, 17994165, 19330901, 22272811, 24782217, 25815341, 27399105, 28033321, 28716248, 28827564, 30957546, 31772610, 33652665, 36157437, 39433142, 8943482 View all (1 more)
Hypertension	Stimulate	21558084, 26391130, 26502942, 27765883, 39595551
Hypertension Pregnancy Induced	Stimulate	39503530
Hypertension Pulmonary	Associate	19390056, 31141166, 35186226
Hypertension Pulmonary	Stimulate	37985458
Hyperthyroidism	Stimulate	24086448
Hyperthyroidism	Associate	29131274, 9222097
Hypertriglyceridemia	Associate	38290570
Hypertrophy	Associate	29436483
Hypertrophy	Stimulate	32100476
Hypertrophy Left Ventricular	Associate	12846758, 29068603
Hyperuricemia	Inhibit	25276832
Hypoalbuminemia	Associate	20583924
Hypoalphalipoproteinemias	Associate	38290570
Hypoglycemia	Associate	17994165
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	17911088
Hyponatremia	Associate	20583924
Hypopigmentation	Associate	22992805
Hypotension	Stimulate	16690359, 22080961
Hypothalamic Diseases	Associate	36389809
Hypothermia	Stimulate	10856867
Hypothermia	Associate	17320940
Hypothyroidism	Inhibit	31350776
Hypothyroidism	Stimulate	31560937
Hypotrichosis	Stimulate	37759728
Hypoxia	Stimulate	11342455, 17568185, 17609976, 20197421, 21409457, 21887369, 22178238, 22303451, 24659848, 24933425, 25881039, 27163161, 27408996, 27858190, 28349784 View all (14 more)
Hypoxia	Associate	1373333, 15847702, 18060036, 18693004, 18986700, 20653473, 23401697, 26001777, 26045772, 31935962, 32028672, 33484391, 34398242, 36814597, 37753073
Hypoxia	Inhibit	23272057
Hypoxia Brain	Stimulate	12699414, 20197421, 24347249, 26229239, 28349784, 28536432
Hypoxia Brain	Associate	18986700, 22117975, 23272057, 32264730
Ichthyosis Bullosa of Siemens	Associate	30622656
Ichthyosis Vulgaris	Associate	37960775
Idiopathic Noncirrhotic Portal Hypertension	Associate	21455331, 25899133
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	29903529, 33723292, 34887625
Idiopathic Pulmonary Fibrosis	Associate	12819039, 23815594, 28139758, 30619270, 32210969, 33746960, 34873957, 34948231, 39229261
IgA Vasculitis	Associate	11991968, 19404965, 20164300, 21548952, 22038403, 8311538, 9502421, 9516466
IgA Vasculitis	Stimulate	26491701
Ige Responsiveness Atopic	Associate	23517389
IgG Deficiency	Associate	7751005
Immune Reconstitution Inflammatory Syndrome	Stimulate	23002445
Immune Reconstitution Inflammatory Syndrome	Associate	26611774, 28316373
Immune System Diseases	Associate	20722464, 23950992
Immune System Diseases	Stimulate	25022969, 35587532
Immunoglobulin G4 Related Disease	Inhibit	19270642
Immunoglobulin G4 Related Disease	Stimulate	32733444
Immunoglobulin G4 Related Disease	Associate	34246246
Immunologic Deficiency Syndromes	Associate	23319571, 31235508, 7723241
Impotence Vasculogenic	Stimulate	27903982
Infarction	Stimulate	33122738
Infarction Middle Cerebral Artery	Associate	25333814
Infections	Stimulate	10900340, 10950106, 11106212, 11781250, 1592439, 1677595, 17395587, 17923525, 21621633, 23150092, 24086645, 24659848, 24696473, 25404022, 26732368 View all (27 more)
Infections	Associate	11049991, 11179309, 1328056, 16306573, 16738534, 18715339, 19442309, 20640364, 21106803, 21209110, 23401697, 24094526, 24334757, 2479021, 25540075 View all (25 more)
Infectious Mononucleosis	Associate	1320953, 32124188, 8298133
Inferior Wall Myocardial Infarction	Stimulate	23696918
Infertility	Associate	10685516, 15831279, 18828896, 29771400
Infertility Female	Associate	37382258
Inflammation	Stimulate	10219766, 11687457, 16464856, 17321344, 18037968, 18262644, 18483242, 18704987, 19012186, 19111481, 19279008, 19775917, 19778662, 20397261, 20511231 View all (100 more)
Inflammation	Associate	10429980, 10504447, 10515411, 10903137, 10998144, 11037875, 11282555, 11348464, 11385615, 11418615, 11507211, 11673534, 11714126, 11777983, 11813166 View all (1514 more)
Inflammation	Inhibit	11705931, 15308667, 18057724, 20653473, 22344199, 23272057, 23971020, 26999659, 28188344, 29230269, 29695657, 31553626, 33196459, 34757857, 35194016, 36372356, 38384034, 39201794 View all (3 more)
Inflammatory Bowel Diseases	Associate	12171960, 18069684, 26497217, 29275959, 31814801, 32020185, 32390702, 36466854, 37306210, 38085149, 39970364, 9099934
Inflammatory Bowel Diseases	Stimulate	27980357, 39487408
Inflammatory Breast Neoplasms	Associate	26207636, 26774497, 27991524, 35927653, 36202317, 36592055, 36873124
Influenza Human	Stimulate	19276177, 19880818, 22022504, 23421931, 25254368, 26696552, 32436879, 33976217
Influenza Human	Associate	22174866, 23148654, 23737648, 24696530, 25176527, 26285213, 26657940, 27088501, 34367124, 37596622
Insulin Resistance	Associate	11287357, 12032168, 12736161, 15180970, 15319170, 15919832, 16926159, 16988089, 17993646, 24397394, 27111539, 27342408, 27903298, 29258102, 30635365, 32651353, 34872092 View all (2 more)
Insulin Resistance	Stimulate	11342531, 17551966, 17993646, 29955086
Insulinoma	Associate	1592439
Intellectual Disability	Associate	25124963
Intermittent Claudication	Associate	19775917
Intervertebral Disc Degeneration	Stimulate	22107760
Intervertebral Disc Degeneration	Associate	22107760, 26587789, 27807886, 28586059, 30511959, 31056946, 33166496, 33764282, 34191345, 35578687, 35964023, 36814575
Intervertebral disc disease	Associate	23014739, 26774625, 31056946, 36293070
Intervertebral disc disease	Inhibit	30248387
Intervertebral Disc Displacement	Associate	23014739, 30511959
Intestinal Diseases	Associate	27980357
Intestinal Obstruction	Associate	35528155
Intestinal Pseudo Obstruction	Stimulate	28323901
Intracranial Aneurysm	Associate	16648144, 35711443, 36451838, 37041519
Intracranial Arteriosclerosis	Associate	38152968
Intracranial Arteriovenous Malformations	Associate	16820800, 18841030
Intracranial Hemorrhages	Associate	29932521
Intrahepatic Cholestasis of Pregnancy	Stimulate	24489901
Intraocular Lymphoma	Associate	27716122, 36721307
Intussusception	Stimulate	34284276
Invasive Pulmonary Aspergillosis	Stimulate	22731696
Invasive Pulmonary Aspergillosis	Associate	24274595
Iridocyclitis	Associate	35178133
Iridogoniodysgenesis type1	Associate	25275318
Iris hypoplasia and glaucoma	Inhibit	34508765
Iron Deficiencies	Stimulate	11737064, 36647855
Iron Deficiencies	Associate	37175630
Iron Metabolism Disorders	Associate	37970725
Iron Overload	Stimulate	40635108
Irritable Bowel Syndrome	Inhibit	18684212
Irritable Bowel Syndrome	Associate	21752155, 28191693
Ischemia	Stimulate	12699414
Ischemic Attack Transient	Associate	38067150
Ischemic Stroke	Associate	33458871, 34921461, 34970793, 35441431, 35503943, 35673992, 37338050
Jaundice	Associate	27252406
Jaw Diseases	Stimulate	22864527
Job Syndrome	Stimulate	10400826
Job Syndrome	Associate	17881745, 21346738, 21792878, 26304966, 29868029, 30309848
Joint Diseases	Associate	28002590
Keloid	Associate	24436441
Keratitis	Associate	25741769
Keratoconus	Stimulate	22413749, 29021606
Keratoconus	Associate	25593510, 27207902, 30245588, 33443628, 36051483
Kidney Calculi	Stimulate	16014026
Kidney Diseases	Associate	18496509, 28827564, 31408438, 35488725, 37273451, 8943482
Kidney Diseases	Stimulate	23582441, 34359843
Kidney Diseases Cystic	Associate	31778601
Kidney Failure Chronic	Associate	10843245, 16760905, 18496509, 19684120, 23019398, 23472199, 23593165, 24755610, 34285273, 35205271, 37439962, 7520955, 8565312
Kidney Failure Chronic	Stimulate	24471420, 34602548
Kidney Failure Chronic	Inhibit	31875015
Kidney Neoplasms	Associate	11849447, 17346426, 26500094, 28328292, 38002360, 38148073
Knee Fractures	Associate	15355555
Labor Pain	Associate	16338780, 20629487, 33910460, 36190386
Labyrinth Diseases	Associate	23912888
Laryngeal Neoplasms	Associate	21845339
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	28349784
Latent Autoimmune Diabetes in Adults	Associate	28573146
Legg Calve Perthes Disease	Associate	25233690
Leigh Disease	Associate	35103930
Leiomyoma	Inhibit	34256950
Leiomyoma	Associate	36771423
Leishmaniasis Diffuse Cutaneous	Associate	8443970
LEOPARD Syndrome	Associate	31112872
Leprosy	Associate	20640364, 23350010, 24578538, 28715406, 33819170
Leprosy Tuberculoid	Associate	33819170, 38167007
Leukemia	Associate	1699919, 1700730, 1712640, 32855274, 7919380, 7949164, 7949177, 9092685
Leukemia	Inhibit	3054878
Leukemia B Cell	Associate	9490667
Leukemia Biphenotypic Acute	Associate	7919380
Leukemia Erythroblastic Acute	Associate	11551897
Leukemia Hairy Cell	Associate	2258703, 8227350
Leukemia Large Granular Lymphocytic	Associate	17156396, 23515927
Leukemia Lymphocytic Chronic B Cell	Associate	10812246, 11133767, 11133769, 1415484, 16113842, 2044220, 22113576, 2258703, 24883303, 25261668, 28722170, 30623437, 31409670, 32855274, 38415531, 9488616 View all (1 more)
Leukemia Lymphoid	Associate	38415531
Leukemia Lymphoma Adult T Cell	Associate	23557330, 32196559, 7949164
Leukemia Monocytic Acute	Associate	10765922, 25367297, 26339660
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1932751, 24819026, 25261668, 2676012, 34493241, 7780147
Leukemia Myeloid	Associate	1932751, 8632998
Leukemia Myeloid Acute	Associate	10586114, 10845908, 11264180, 1613267, 1698479, 1699919, 1712640, 23616009, 25261668, 26468600, 27577048, 3042049, 31322275, 31373163, 32995942 View all (8 more)
Leukemia Myeloid Acute	Inhibit	14578205
Leukemia Myeloid Acute	Stimulate	28084439
Leukemia Myelomonocytic Chronic	Associate	26076658, 2676012, 30026572, 31648319
Leukemia Plasma Cell	Associate	10196314, 2495201, 26722442, 2785119, 35610009
Leukemia Prolymphocytic T Cell	Associate	24219331
Leukemia Promyelocytic Acute	Associate	10622210, 8193361
Leukemia T Cell	Associate	8132223
Leukemic Infiltration	Associate	30516819
Leukocytosis	Stimulate	11432624
Leukocytosis	Associate	2212010, 33919834
Leukoencephalopathies	Associate	18436879, 23432807
Leukoencephalopathies	Stimulate	36280708
Leukomalacia Periventricular	Associate	24903966, 30517142
Lichen Planus	Associate	26632637
Lichen Planus Oral	Associate	27544215, 35064144, 7738356
Lichen Sclerosus et Atrophicus	Associate	35103930
Light Fixation Seizure Syndrome	Associate	28592438, 33584644
Light Fixation Seizure Syndrome	Stimulate	37404831
Lipedema	Associate	32271442
Liver Cirrhosis	Associate	39766906
Liver Cirrhosis Biliary	Stimulate	12077104, 31867004
Liver Cirrhosis Biliary	Associate	14730602, 15884119, 19604266, 34367180, 38228248
Liver Cirrhosis Biliary	Inhibit	1772964
Liver Diseases	Inhibit	1772964
Liver Diseases	Associate	19438606, 24905921, 39766906
Liver Diseases Alcoholic	Stimulate	12547716
Liver Diseases Alcoholic	Associate	38146363
Liver Failure	Stimulate	23582441, 33356606
Liver Failure	Associate	28876364, 31534132, 33991637, 35529862, 37175814
Liver Failure Acute	Associate	12970895
Liver Failure Acute	Inhibit	1772964
Liver Neoplasms	Associate	24912675, 32924606
Liver Neoplasms	Stimulate	26301107
Locked In Syndrome	Stimulate	26360770
Low Tension Glaucoma	Associate	34599867
Lown Ganong Levine Syndrome	Associate	8750057
Lumbar Stenosis Familial	Associate	29436483
Lung Diseases	Associate	10843457, 17078813, 17490702, 20438838, 25289758, 33390771, 34246246, 34789453, 36480571, 36852851, 37052526, 37653422
Lung Diseases	Stimulate	23582441, 24696530, 30249899
Lung Diseases	Inhibit	23743311
Lung Diseases Interstitial	Associate	23592411, 32271462, 32602227, 32691471, 33080140, 33446609
Lung Diseases Interstitial	Stimulate	33298584
Lung Diseases Obstructive	Associate	29319364
Lung Injury	Associate	11028659, 17052299, 19359268, 20512931, 23251429, 26851119, 33390771
Lung Neoplasms	Associate	11504947, 15894558, 16276011, 21048114, 21122157, 21881374, 23052692, 24420154, 24907005, 24988892, 25461668, 25514196, 26372664, 26484608, 26486080 View all (22 more)
Lung Neoplasms	Stimulate	15048152, 19124500, 27095254, 30953795, 31196220, 31552680
Lupus Erythematosus Systemic	Associate	11342672, 1563109, 17082661, 17608810, 19199277, 19380809, 19448905, 20334681, 20434119, 20954190, 24106699, 24829414, 25109676, 25345743, 26516833 View all (21 more)
Lupus Erythematosus Systemic	Stimulate	12480667, 15751081, 19448905, 24083390, 24288552, 24433387, 25548434, 26457008, 26583155, 26790609, 27852285, 27914596, 28320468, 29271478, 29563616 View all (9 more)
Lupus Erythematosus Systemic	Inhibit	19644848, 9010506
Lupus Nephritis	Associate	27716443, 30594048, 31685786
Lupus Nephritis	Stimulate	27738386
Lupus Vasculitis Central Nervous System	Stimulate	40348638
Lymphatic Diseases	Associate	10515899
Lymphatic Metastasis	Stimulate	17094421, 28791816
Lymphatic Metastasis	Associate	17189976, 28348483, 32329850, 32705271, 34165442
Lymphatic Vessel Tumors	Associate	9490667
Lymphedema	Associate	27366905
Lymphohistiocytosis Hemophagocytic	Associate	1954380, 34461635, 35510179
Lymphohistiocytosis Hemophagocytic	Stimulate	21325597
Lymphoma	Associate	10196314, 11426493, 15691277, 22016619, 26987877, 27430206, 2787680, 29523105, 30047815, 3052631, 3054878, 31601188, 33009434, 33578562, 35432366, 37975847 View all (1 more)
Lymphoma	Stimulate	20963937
Lymphoma AIDS Related	Associate	9792301
Lymphoma B Cell	Associate	1320956, 1415484, 1652755, 2785119, 7949151, 9674742
Lymphoma B Cell Marginal Zone	Associate	35484662
Lymphoma Follicular	Associate	15070705, 24836297
Lymphoma Large B Cell Diffuse	Associate	1415484, 15755285, 18160665, 19716854, 22323454, 27394196, 27799566, 28031410, 29295936, 29496671, 31794606, 31886296, 33578562, 36104733
Lymphoma Large Cell Anaplastic	Stimulate	11426493
Lymphoma Large Cell Anaplastic	Associate	1951632, 38143760
Lymphoma Large Cell Immunoblastic	Associate	1415484
Lymphoma Mantle Cell	Associate	22915070, 25216518, 27697772, 28529032
Lymphoma Non Hodgkin	Associate	10477738, 16449530, 19606255, 22113576, 22820139, 25422198, 26381542, 28246881, 36193491, 9792301
Lymphoma Non Hodgkin	Stimulate	25422198
Lymphoma Primary Effusion	Associate	10196314, 10515891, 10515899, 11781250, 12134031, 24198402, 25078695, 28878084, 32669340, 35089062
Lymphoma T Cell	Associate	32124188, 35014680
Lymphoma T Cell Cutaneous	Associate	11807001, 32270320
Lymphoma T Cell Peripheral	Associate	10748876
Lymphopenia	Associate	32320677, 34123873, 36263058
Lymphoproliferative Disorders	Associate	20644113, 2258703, 28241173, 7595192
Macrophage Activation Syndrome	Associate	24098711, 33952771
Macular Degeneration	Associate	18538409, 24036938, 26330749, 29348424, 33510953, 34445430, 39959181
Macular Degeneration	Stimulate	23946637, 39959178
Macular Degeneration	Inhibit	34202702
Macular Edema	Associate	24319335, 33101305
Majeed syndrome	Associate	33314777
Malaria	Associate	25038626, 31792230, 33424841
Malaria	Inhibit	27027867, 30380038
Malaria Vivax	Associate	25038626
Malignant hyperthermia susceptibility type 1	Associate	2103309
Malnutrition	Stimulate	31398886
Malnutrition	Associate	36248906
Marfan Syndrome	Associate	37445606
Mast Cell Activation Disorders	Stimulate	26774658
Mast Cell Activation Disorders	Associate	31708535, 33882986
Mastocytosis	Associate	23078005, 26774658, 30948489
Mastocytosis Systemic	Associate	30948489
Mastodynia	Associate	28764974
Measles	Associate	18715339
Mediastinal Neoplasms	Associate	7813103
Medulloblastoma	Associate	10480339, 33279931, 35159191
Medulloblastoma	Stimulate	29207075, 32539808
Meibomian Gland Dysfunction	Associate	28887117
Meibomian Gland Dysfunction	Stimulate	35468976
Melanoma	Associate	11442760, 12706815, 1347555, 1544709, 16278308, 16801397, 16835788, 17141217, 17374732, 18996182, 19443406, 20181932, 21048114, 21268068, 21853302 View all (16 more)
Melanoma	Stimulate	35538545, 37481560
Memory Disorders	Associate	17994165
Meniere Disease	Associate	34920656
Meningioma	Associate	12117909, 32832554
Meningitis Aseptic	Associate	12605702
Meningitis Bacterial	Associate	21473761
Meningitis Fungal	Stimulate	36946852
Meningitis Meningococcal	Associate	11598066
Meningitis Viral	Associate	27914455
Meningitis Viral	Stimulate	29917201
Meningococcal Infections	Associate	11254640, 8277177
Meningoencephalitis	Associate	7890425
Mental Disorders	Associate	35353173
Mesangial sclerosis diffuse	Associate	29708439, 8943482
Mesothelioma	Associate	38029536
Mesothelioma Malignant	Associate	21048114, 2787682
Metabolic Diseases	Associate	25993353
Metabolic Syndrome	Associate	17596140, 20016051, 20156756, 20186139, 20869059, 25464926, 25815341, 26052894, 26864064, 28763032, 30383538, 30635365, 31798282, 32382575, 32751810 View all (4 more)
Metabolic Syndrome	Stimulate	22357188, 22991262, 29670915
Metaplasia	Associate	9665475
Methylmalonic acidemia with homocystinuria	Stimulate	17023704
Microphthalmia Syndromic 10	Associate	27981440
Mitochondrial Diseases	Stimulate	30753671, 33097606, 39174953
Mitochondrial Diseases	Associate	39266981
Mitral Valve Insufficiency	Stimulate	24330612
Mixed Tumor Malignant	Associate	15921527
Monoclonal Gammopathy of Undetermined Significance	Associate	27400413, 9609524
Monocyte Chemotactic Disorder	Associate	26518043
Mosaic variegated aneuploidy syndrome	Stimulate	17537851
Mouth Diseases	Associate	23226210, 24453419, 29018115
Mouth Neoplasms	Associate	17177164, 18360107, 21710491, 22103462, 27742160, 33551310, 34384424
Movement Disorders	Associate	29168181
Mucocutaneous Lymph Node Syndrome	Stimulate	10233729, 20718783, 25039241, 32884012, 34035116, 37506144
Mucocutaneous Lymph Node Syndrome	Associate	21048327, 23298273, 27867156, 31043452, 33381571, 35222381, 35699824, 36449533, 37820655, 7851022
Mucormycosis	Associate	34861346
Multi centric Castleman's Disease	Associate	10196314, 10482577, 11781250, 11895764, 20583924, 20644113, 23372742, 24198402, 26250536, 28878084, 29675946, 31077056, 31408438, 32206779, 32669340, 34438448, 35488725, 39210558 View all (3 more)
Multi centric Castleman's Disease	Stimulate	34246246, 34686774, 36990774
Multiple Myeloma	Associate	10029602, 10233376, 10460618, 10482577, 10583232, 10602002, 10620064, 10720689, 10753844, 10848780, 10880513, 10929036, 11030205, 11050000, 11090073 View all (177 more)
Multiple Myeloma	Stimulate	14975242, 15070698, 15287939, 15730850, 16373656, 18830264, 18927280, 25341809, 28677723, 31784427
Multiple Organ Failure	Associate	15288631, 26463449
Multiple Sclerosis	Stimulate	12562396, 31857644
Multiple Sclerosis	Associate	17258784, 23202972, 24155968, 25704169, 26285213, 26640809, 27629486, 29518260, 30409508, 30917537, 33240262, 33919169, 35386698, 35627281, 35767891, 36604748, 36725329, 39201794, 9523575 View all (4 more)
Multiple Sclerosis Relapsing Remitting	Associate	23637915, 35627281
Muscle Neoplasms	Stimulate	28114971
Muscle Neoplasms	Associate	29687616
Muscle Weakness	Associate	24106699, 37468473
Muscular Atrophy	Associate	17609255, 29091763, 35967380
Muscular Atrophy	Stimulate	23825078
Muscular Diseases	Associate	21436461, 24106699, 28481416
Muscular dystrophy congenital with central nervous system involvement	Associate	23432807
Muscular Dystrophy Duchenne	Associate	15005841, 15355555, 36814107
Muscular Dystrophy Duchenne	Stimulate	21842588
Myasthenia Gravis	Inhibit	25518708
Myasthenia Gravis	Associate	36647855
Myasthenia Gravis	Stimulate	39346912
Myasthenic Syndromes Congenital	Associate	16272363
Mycobacterium avium intracellulare Infection	Associate	2029580
Mycobacterium avium intracellulare Infection	Stimulate	9657559
Mycobacterium Infections Nontuberculous	Associate	16622205
Mycoses	Associate	25741769, 29673332
Mycoses	Inhibit	28346317
Myelodysplastic Syndromes	Stimulate	25679997, 40635108
Myelodysplastic Syndromes	Associate	27722177, 35367529, 7538815
Myelodysplastic Syndromes	Inhibit	30825517
Myocardial Infarction	Stimulate	10475771, 11714126
Myocardial Infarction	Associate	16820586, 17241179, 20585578, 27627640, 28260995, 32515246, 33174867, 38067150
Myocardial Reperfusion Injury	Associate	34135690
Myoepithelioma	Associate	32636303
Myopathies Structural Congenital	Associate	27222359, 29253845
Myopathy Central Core	Stimulate	15299003
Myopathy Central Core	Associate	21088110
Myopia	Associate	35405674
Myositis	Associate	27936488, 36801811, 37228600
Myotonic Dystrophy	Associate	21414848, 29091763, 30845774, 37468473
Myotonic Dystrophy	Inhibit	26211001
Myotonic Dystrophy	Stimulate	32933141
Mysophobia	Associate	25526183, 35432366
Myxoma	Associate	8343326
Nasal Polyps	Associate	26266960, 31870738, 33785041, 37047067
Nasopharyngeal Carcinoma	Associate	20964870, 24504675, 24952889, 26453114, 28732079, 30849642, 32308549, 34165442, 34452547, 39304953
Nasopharyngeal Carcinoma	Stimulate	28207826
Neck Pain	Stimulate	38097400
Necrobiotic Xanthogranuloma	Stimulate	24428816
Necrosis	Associate	1597519, 20397261
Necrosis	Stimulate	20309865
Neonatal Sepsis	Associate	29532452
Neoplasm Invasiveness	Stimulate	17094421
Neoplasm Invasiveness	Associate	27356714, 27744625
Neoplasm Metastasis	Associate	18205904, 19497133, 19687301, 19833726, 24446297, 25213863, 25761055, 26173622, 26215971, 26331965, 26513016, 26810186, 27992365, 28427199, 28732081 View all (20 more)
Neoplasm Metastasis	Stimulate	22235336, 30333255, 32539808, 35194016, 35859428, 36317517
Neoplasm Seeding	Stimulate	15361708
Neoplasms	Associate	10408408, 10480339, 10515899, 10682675, 10886511, 10889822, 10908158, 10925276, 11090073, 11154226, 11169220, 11781250, 11920517, 12165085, 12445202 View all (363 more)
Neoplasms	Stimulate	10543258, 17261184, 18294286, 18697197, 19351789, 19685052, 21131600, 22029859, 22203932, 22429778, 23200412, 23684136, 25778334, 26201938, 26528857 View all (14 more)
Neoplasms	Inhibit	15904949, 21710491, 22113576, 23272057, 25231991, 2553849, 26338965, 30180849, 3054878, 34195849, 37063865, 8142657
Neoplasms Adipose Tissue	Associate	18239642, 19553556, 21197447, 22709547, 24962479, 26086344, 26514561, 28500271, 28787364, 29229927, 30224430, 34872092, 35894174, 36791082, 37282843
Neoplasms Adipose Tissue	Stimulate	23505192, 29670915
Neoplasms Cystic Mucinous and Serous	Stimulate	10682675
Neoplasms Cystic Mucinous and Serous	Associate	23889749, 25007180
Neoplasms Glandular and Epithelial	Associate	16489115
Neoplasms Plasma Cell	Associate	30825517
Neoplasms Squamous Cell	Associate	25889974
Neoplastic Cells Circulating	Associate	15920147
Nephritis	Associate	8258957
Nephritis Interstitial	Associate	30088539, 8258957
Nephrosis congenital	Associate	29190601
Nephrosis Lipoid	Stimulate	28084439
Nephrotic Syndrome	Stimulate	20446793
Nephrotic Syndrome	Associate	35837376
Nerve Compression Syndromes	Associate	32717400
Nerve Degeneration	Associate	21842588
Nervous System Diseases	Associate	14686749, 32038109, 37577373
Neural Tube Defects	Associate	11426493
Neuralgia	Associate	29672183, 30248387, 32213162
Neuralgia Postherpetic	Associate	25127283
Neuroblastoma	Stimulate	18450743
Neuroblastoma	Associate	19671870, 21833997, 23633489, 24204677, 27866306, 29692379, 34993731, 35887076
Neurocognitive Disorders	Associate	25214388
Neurodegenerative Diseases	Associate	20488324, 9003059
Neurodermatitis	Associate	33183050
Neuroendocrine Tumors	Associate	26846108
Neuroinflammatory Diseases	Associate	21712995, 26270987, 30409508, 32688141, 33113430, 35627281, 37735116, 38238463, 40710309
Neurologic Manifestations	Associate	27576738
Neurologic Manifestations	Stimulate	34450402
Neuromyelitis Optica	Associate	21321193, 23637915, 28946890, 40103346, 40294019
Neuromyelitis Optica	Stimulate	32753407
Neurotoxicity Syndromes	Associate	27104929, 30615147, 32669372, 36160711
Neutropenia	Stimulate	7605999
Neutrophilia Hereditary	Associate	24750386
Nevus Pigmented	Associate	9077486
Niemann Pick Disease Type C	Associate	19497133
Non alcoholic Fatty Liver Disease	Associate	18376369, 27730688, 30001365, 34025683, 34552988, 34813621, 36380355, 37373554, 38015590
Non alcoholic Fatty Liver Disease	Stimulate	25747354
Non alcoholic Fatty Liver Disease	Inhibit	36093484
Non Radiographic Axial Spondyloarthritis	Associate	17665434, 28002590
Nose Diseases	Stimulate	23517389
Nose Diseases	Associate	23771534, 33919374
Obesity	Associate	11287357, 12690081, 12917504, 15292466, 16464856, 16493118, 16968396, 16988089, 17993646, 18069022, 18239554, 19218687, 19876004, 20156727, 20825686 View all (62 more)
Obesity	Stimulate	18262644, 20739506, 21558084, 24568505, 26246197, 26516848, 26694359, 27535280, 28019133, 28103807, 28963085, 29244802, 30845774, 31533725, 32849611 View all (6 more)
Obesity	Inhibit	20157327, 24741586, 36428961
Obesity Abdominal	Associate	25815341, 28103807, 29670915, 31301734
Obesity Maternal	Stimulate	25547282, 35304898
Obesity Maternal	Associate	28625035
Obesity Metabolically Benign	Associate	27907186
Obsessive Compulsive Disorder	Associate	22311210
Obstetric Labor Premature	Associate	38290925
Ocular Hypertension	Associate	33216119
Oculocutaneous albinism type 2	Associate	30211653
Odontogenic Tumors	Associate	21196890
Odontoma	Associate	23152884
Olfaction Disorders	Stimulate	35931372
Oncogene Addiction	Associate	18555778
Oncogene Addiction	Stimulate	24499937
Opioid Related Disorders	Associate	30071446, 31513981
Opioid Related Disorders	Inhibit	31687981
Optic Atrophy	Associate	37946484
Optic Nerve Hypoplasia	Stimulate	36423879
Optic Neuritis	Associate	40348638
Optic Neuropathy Ischemic	Stimulate	21418620
Organizing Pneumonia	Associate	36263058
Oropharyngeal Neoplasms	Associate	31187548
Osteitis Deformans	Associate	24355795
Osteoarthritis	Associate	10632674, 10703936, 16198603, 16806998, 18257935, 21172926, 22362494, 25407789, 25917063, 26450708, 26578807, 26600476, 26982743, 27082319, 27404795 View all (38 more)
Osteoarthritis	Stimulate	22275154, 22380539, 24286485, 25888873, 30186872, 31017304, 32213162, 34158566, 34448795, 35955467
Osteoarthritis Hip	Associate	16198603, 28860542
Osteoarthritis Knee	Associate	19877065, 21863560, 29283192, 30635366, 32059658, 32131377, 32409720, 33036557, 33903094, 34073132, 39341952
Osteoarthritis Knee	Stimulate	21538317, 26600476, 31898441, 40211184
Osteoarthropathy Primary Hypertrophic	Stimulate	28851954
Osteoglophonic dwarfism	Stimulate	32417847
Osteolysis	Associate	19860911
Osteomyelitis	Associate	18971305, 32454789
Osteoporosis	Associate	10599049, 10620056, 11212160, 12009364, 15005841, 15355555, 25384921, 29521042, 29745905, 30967152, 31301734, 32080087, 36105394, 36316863, 36451445 View all (6 more)
Osteoporosis	Stimulate	11113455, 22380539, 37038178
Osteoporosis pseudoglioma syndrome	Associate	15355555
Osteoporotic Fractures	Associate	29521042
Osteoporotic Fractures	Stimulate	40065254
Osteosarcoma	Associate	24455684, 26810186, 27851822, 29048621
Otitis	Associate	19522649
Otitis Media	Inhibit	23576001
Otitis Media with Effusion	Associate	11282555
Ototoxicity	Associate	29162613
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis	Associate	24119518
Ovarian Diseases	Associate	37883761
Ovarian Neoplasms	Associate	10682675, 14670967, 14715418, 16368063, 17023036, 17565609, 17617741, 18587580, 18624749, 19398128, 25376541, 25658637, 26238017, 26561720, 27035765 View all (30 more)
Ovarian Neoplasms	Inhibit	32727400
Ovarian Neoplasms	Stimulate	33062717, 36675246, 37322531
Overweight	Associate	16493118, 18239642, 19189403
Overweight	Stimulate	28963085
Pain	Associate	14686749, 18990769, 19180509, 22337942, 23864770, 25469832, 26245191, 26945673, 26985948, 27856968, 28764974, 31056946, 32213162, 32487996, 32717400, 33848569, 34191345, 37202736 View all (3 more)
Pain	Stimulate	32383346, 34602367
Pancreatic Neoplasms	Associate	17568185, 19745053, 21515913, 21737619, 21880146, 23458624, 25409614, 25609203, 25807437, 29693005, 29853638, 31230062, 31424683, 31609478, 32463297 View all (4 more)
Pancreatic Neoplasms	Inhibit	23272057
Pancreatic Neoplasms	Stimulate	40170581
Pancreatitis	Associate	11777983, 20397261, 28935577, 32549759, 32865617, 35205334, 35946453, 40450371
Pancreatitis	Stimulate	31314190
Pancreatitis Chronic	Stimulate	18053242, 33893003
Panic Disorder	Associate	26283638
Papillomavirus Infections	Associate	27783717, 33797568, 34684062
Paraganglioma	Associate	37780619
Paramyxoviridae Infections	Stimulate	15273081
Paramyxoviridae Infections	Associate	20182399
Paraneoplastic Syndromes	Associate	2212010
Paraparesis Tropical Spastic	Associate	26609200, 30466392
Parasitic Diseases	Stimulate	37710023
Parkinson Disease	Associate	17189976, 22155094, 26911448, 28943632, 31828965, 33029617, 33577043, 34536521, 34660782, 36926335, 39229261
Parkinson Disease	Stimulate	24593806, 27735031, 35656776, 36768317
Paroxysmal nonkinesigenic dyskinesia	Associate	21912648
Paroxysmal ventricular fibrillation	Associate	26864064
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	28464955
pediatric multisystem inflammatory disease COVID 19 related	Stimulate	34035116
Pelvic Organ Prolapse	Associate	19056808, 37266648
Pemphigoid Bullous	Associate	27868136, 35140724, 35921900
Pemphigus	Stimulate	18373702
Pemphigus	Associate	31211854
Penile Neoplasms	Associate	37763742
Peptic Ulcer	Associate	25753878
Peri Implantitis	Stimulate	33291232, 35742682
Peri Implantitis	Associate	34931168
Periapical Granuloma	Associate	39401546
Periapical Periodontitis	Stimulate	35300329
Periapical Periodontitis	Associate	40280320
Periodic fever familial autosomal dominant	Associate	21225679, 26278305, 31009059
Periodic fever familial autosomal dominant	Stimulate	37500699
Periodontal Diseases	Associate	17286759, 20682019, 24557363, 29538476, 39337647
Periodontal Pocket	Associate	34070915
Periodontitis	Associate	17286759, 23046796, 23428978, 27602578, 31978095, 32215496, 33208145, 33291232, 35844512, 37342352, 39266981, 7642293, 8608641
Periodontitis	Stimulate	22926406, 28320468, 34213019, 34502071, 35139411
Peripheral Arterial Disease	Associate	16443741, 19761682, 19778662, 20385468, 34993731, 38152968, 39863282
Peripheral Arterial Disease	Stimulate	24913105, 25095746, 28406704, 29587258
Peripheral Arterial Occlusive Disease 1	Associate	12217290, 17598820
Peripheral Nervous System Diseases	Stimulate	27981790
Periprosthetic Fractures	Associate	29305046, 35306116
Peritonitis	Associate	28490530
Persistent Infection	Stimulate	32408187
Personality Disorders	Associate	11154226, 21258401, 23388133, 25750173, 27356714, 33038372, 34633095, 36932385, 37075625
Phenylketonurias	Associate	25003325
Philadelphia Chromosome	Associate	38172124
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	36766809
Pituitary Neoplasms	Associate	27050975
Placenta Diseases	Associate	30402038
Plague	Associate	21106776
Plaque Atherosclerotic	Associate	11714126, 20536609, 21757719, 27034587, 28686728
Plasmablastic Lymphoma	Associate	28860565, 34714908
Plasmacytoma	Associate	1710152, 2464001, 2783861, 3493322, 8145046
Platelet Signal Processing Defect	Associate	22751495
Pleural Effusion	Associate	1371640, 9519218
Pleural Effusion	Stimulate	33347836
Pneumococcal Infections	Associate	12952922, 23865742
Pneumococcal Infections	Stimulate	37358300
Pneumoconiosis	Stimulate	27265534
Pneumonia	Associate	20650996, 20884746, 22142850, 28403117, 30157804, 32564053, 32941953, 33347836, 34353696, 34643152, 35685584, 36034211, 36195304, 37243282, 37725516, 39229261, 39809213 View all (2 more)
Pneumonia	Stimulate	22022504, 31257245
Pneumonia Lipid	Associate	15292466, 17362351
Pneumonia Mycoplasma	Associate	33347836
Pneumonia Pneumocystis	Associate	36389809
Pneumonia Staphylococcal	Associate	27615723, 35319722
Pneumonia Ventilator Associated	Associate	32940422
Pneumothorax	Inhibit	20653473
POEMS Syndrome	Associate	35488725
Polycystic Ovary Syndrome	Associate	15193488, 22344199, 24114630, 25446648, 28019133, 31999854, 32454906, 33094626, 33308258
Polycystic Ovary Syndrome	Stimulate	24628003, 28868943, 32785222
Polycythemia	Stimulate	33710927
Polycythemia Vera	Stimulate	35025147
Polyendocrinopathies Autoimmune	Associate	19037923
Polymyalgia Rheumatica	Associate	34664888, 34993731, 8083354
Polymyositis	Associate	29239244
Polyps	Stimulate	23771534, 32352715
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	12819039, 27211560, 37626843
Polysaccharide Storage of Unusual	Associate	22226452
Popliteal Artery Aneurysm	Stimulate	20488324
Post Acute COVID 19 Syndrome	Stimulate	33193384, 36997530
Post Acute COVID 19 Syndrome	Associate	36757946, 38231284, 39578766, 39987891
Post Acute COVID 19 Syndrome	Inhibit	37753077
Post Infectious Disorders	Associate	28410580, 29194369
Posterior Leukoencephalopathy Syndrome	Stimulate	29271478
Postoperative Cognitive Complications	Stimulate	29949172
Postoperative Complications	Associate	14566255, 26231560
Pre Eclampsia	Associate	18382655, 18467705, 18986700, 24659862, 26010865, 27999241, 28566469, 33026915, 36047133, 39202588
Pre Eclampsia	Stimulate	24612145, 25461403, 27780270, 28502089, 36683689, 36834513
Precancerous Conditions	Associate	22876438, 26338965, 26372664, 31515600
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30443842, 32767331, 39273528
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11459169, 31943135
Preeclamptic toxemia	Stimulate	18467705, 21253506, 31138166
Pregnancy Complications	Associate	28515391, 35255856
Pregnancy Tubal	Stimulate	31088412
Prehypertension	Associate	34230468
Premature Birth	Associate	22752762, 30731481, 34169316, 34195300
Premature Birth	Stimulate	36027951
Pressure Ulcer	Associate	12846758
Preterm Premature Rupture of the Membranes	Associate	19272692, 38290925
Primary Graft Dysfunction	Associate	23710539
Primary Myelofibrosis	Associate	22081434, 26491227, 31369569, 31408438
Primary Myelofibrosis	Stimulate	39391311
Prion Diseases	Associate	9003059
Prodromal Symptoms	Associate	22126569
Progressive Transformation of Germinal Centers	Associate	10515899
Prostatic Hyperplasia	Associate	21081304, 28735516, 29938471, 30345492, 34606081, 37378942, 37847180
Prostatic Intraepithelial Neoplasia	Associate	17094460
Prostatic Neoplasms	Associate	10391095, 11389966, 11733366, 11751884, 12163482, 12902351, 15672864, 17094460, 17346688, 17878531, 18303206, 18601766, 18615482, 19147545, 19240160 View all (71 more)
Prostatic Neoplasms	Stimulate	17148681, 19189403, 19351789, 31348843
Prostatic Neoplasms Castration Resistant	Stimulate	17595657
Prostatic Neoplasms Castration Resistant	Associate	19805306, 28561752, 30410767, 31013891, 35184651, 35782093, 36982155
Prostatitis	Associate	11141475, 11713282, 16278308, 17094460, 18303206, 19242540, 19351789, 21258401, 21535317, 24446297, 24664372, 26048576, 26375444, 27012192, 27732936
Prostatitis	Stimulate	28467474
Prosthesis Failure	Associate	18634020
Protein Energy Malnutrition	Associate	38017491
Protein Losing Enteropathies	Associate	35318338
Proteinuria	Associate	26517838, 34245398, 8258957, 8268396
Proteinuria	Stimulate	38401467
Psoriasis	Associate	16864908, 18669614, 30301277, 30998987, 33259876, 38115636
Psoriasis	Stimulate	21681565
Psychological Trauma	Associate	29301248
Psychomotor Disorders	Associate	34535767
Psychotic Disorders	Associate	25214388, 40348638
Pulmonary Arterial Hypertension	Stimulate	20808962
Pulmonary Arterial Hypertension	Associate	24083390, 29629898, 32029443, 32813135, 34445297, 34588193, 34993731, 35960497, 36157437, 36871578, 37516840
Pulmonary Atelectasis	Associate	34089082
Pulmonary Disease Chronic Obstructive	Associate	11106212, 14624669, 17395587, 18693004, 19359268, 21037957, 21814463, 24975928, 25183374, 25535123, 26001777, 27036869, 27060571, 28963085, 29065892 View all (25 more)
Pulmonary Disease Chronic Obstructive	Stimulate	17626109, 19179485, 19272152, 20395558, 20500811, 24438094, 25125975, 26403459, 28178340, 28476471, 28494757, 28979110, 33590951, 34323408
Pulmonary Disease Chronic Obstructive	Inhibit	26617776, 30390648, 34815425
Pulmonary Edema	Associate	34883250
Pulmonary edema of mountaineers	Associate	25525212
Pulmonary Embolism	Stimulate	33969714, 35395844
Pulmonary Fibrosis	Associate	20507572, 25535123, 32210969, 33832291
Pulmonary Heart Disease	Associate	31599438
Purpura Thrombocytopenic Idiopathic	Associate	15755291, 22111667, 34329516
Purpura Thrombocytopenic Idiopathic	Stimulate	31014934
Purpura Thrombocytopenic Idiopathic	Inhibit	32677050
Q Fever	Associate	31001808
Q Fever	Stimulate	8613372
Quadricuspid Aortic Valve	Associate	30883599
Radiation Injuries	Associate	23512358
Radiation Pneumonitis	Associate	34964782
Rapidly progressive glomerulonephritis with pulmonary hemorrhage	Associate	14566255
Rectal Neoplasms	Associate	19452524, 26559268
Rectovaginal Fistula	Stimulate	24453419
Renal cell carcinoma 1	Associate	31891569
Renal Insufficiency	Stimulate	21917895
Renal Insufficiency	Associate	29305046, 33764817, 37628639, 39962550, 8840280
Renal Insufficiency Chronic	Inhibit	16738534
Renal Insufficiency Chronic	Stimulate	16760905, 21228768, 27992360, 31778601, 34359843, 40184113
Renal Insufficiency Chronic	Associate	18547996, 22230215, 22911697, 23593165, 26463449, 30249039, 30280599, 31687048, 32046176, 34285273, 34315328, 36102277, 38017491, 8278382
Reperfusion Injury	Stimulate	20348235
Reperfusion Injury	Associate	33484391, 37735391
Reperfusion Injury	Inhibit	33484391
Respiratory Distress Syndrome	Associate	11687457, 16689659, 23251429, 26033126, 27095254, 31261506, 33422148, 33828172, 34556700, 34757857, 34883088, 36927455
Respiratory Distress Syndrome	Stimulate	22835422, 34163488
Respiratory Insufficiency	Associate	23737648, 24094526, 32924606, 33348065, 34526076, 34638691, 34757857, 34775962
Respiratory Syncytial Virus Infections	Associate	20001857
Respiratory System Abnormalities	Associate	34664888, 40218996
Respiratory Tract Diseases	Associate	28230530, 28660319, 32472750, 7813103
Respiratory Tract Infections	Stimulate	30193587
Respiratory Tract Infections	Associate	33828172
Retinal Detachment	Stimulate	26015767, 32542038
Retinal Detachment	Associate	29263305, 32957329, 33371882, 34544594
Retinal Necrosis Syndrome Acute	Stimulate	28395298
Retinal Perforations	Stimulate	19255163
Retinal Vein Occlusion	Associate	25978399, 31814701, 35370941, 36180575
Retinoblastoma	Associate	10229675
Retroperitoneal Fibrosis	Stimulate	32733444
Rheumatic Diseases	Associate	31861245
Rhinitis Allergic	Associate	22533231, 26909898, 33966399, 35190755, 37713866
Rhinitis Allergic	Stimulate	31185305, 33224143, 36032502
Rhinitis Allergic	Inhibit	37634407
Ring Chromosome 20 Syndrome	Stimulate	28578351, 32417847, 37506161
Rotator Cuff Injuries	Associate	22337942, 26191285, 33407301
Rubella	Associate	18715339, 29253144
Rubella	Stimulate	35178133
Rupture	Associate	22337942
Salivary Gland Adenoma Pleomorphic	Associate	27286739, 8198972
Salivary Gland Neoplasms	Associate	28039719
Salpingitis	Stimulate	31088412
Sarcoidosis	Associate	12946220, 24768588, 27402699, 39284999
Sarcoidosis	Stimulate	27929051
Sarcoma	Associate	1652755, 34982796, 39778225
Sarcoma Clear Cell	Associate	23058034
Sarcoma Ewing	Associate	25092916, 26215971, 33682749
Sarcoma Ewing	Stimulate	34440851
Sarcoma Kaposi	Associate	10196314, 10482577, 11001912, 11050002, 11264189, 11781250, 12134031, 15154666, 20583924, 21984125, 23818101, 24198402, 26646010, 28878084, 32669340 View all (6 more)
Sarcoma Synovial	Associate	24373201
Sarcopenia	Associate	39519004
Schizophrenia	Stimulate	24984193, 29803226, 38066312
Schizophrenia	Associate	25214388, 25433960, 26462458, 30630651, 32038109
Schnitzler Syndrome	Associate	29284595
Scleritis	Associate	37063831
Scleroderma Localized	Associate	37372943
Scleroderma Systemic	Associate	11710721, 17125598, 19536281, 31178673, 31545397, 33922041
Scleroderma Systemic	Stimulate	24083390, 30157947
Scoliosis	Associate	26199858, 36670417
Seizures	Associate	29194369, 32219137, 40348638
Seizures Febrile	Associate	26960986
Seizures Febrile	Stimulate	34449141, 38218765
Seminoma	Associate	28544640
Sepsis	Associate	10477399, 14500502, 17210974, 18949559, 22187279, 26125767, 26463449, 31415369, 32484987, 34461635, 35491874
Sepsis	Stimulate	23679576, 32496420, 32996896, 35095877
Sepsis	Inhibit	30666251
Sepsis Associated Encephalopathy	Stimulate	37812997
Sepsis Associated Encephalopathy	Associate	39966958
Severe Acute Respiratory Syndrome	Stimulate	17052299, 32217835
Severe Acute Respiratory Syndrome	Associate	17490702, 20015551, 26893103, 27095254, 32320677, 37261339
Severe Dengue	Stimulate	31521850
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Sezary Syndrome	Associate	27039262
Shock Septic	Associate	11093140, 1989598, 37359526
Shock Septic	Stimulate	33939645, 34035116
Shoulder Pain	Stimulate	31238711
Shoulder Pain	Associate	37864374
Shwachman Diamond Syndrome	Associate	40021961
Sick Sinus Syndrome	Stimulate	39210558
Signs and Symptoms	Associate	28797847
Signs and Symptoms Digestive	Associate	29434052
Signs and Symptoms Respiratory	Associate	20839488
Simpson Golabi Behmel syndrome	Associate	25079398
Sjogren's Syndrome	Stimulate	18209090, 27207443, 28379971, 29846789, 37418983
Sjogren's Syndrome	Associate	19700754, 22018243, 24827536, 29504848, 30150979, 32576236, 32914376, 34909885, 34993731, 35705251, 36999025, 38013284, 39819714, 40650157, 9867125
Skin Diseases	Associate	15654950, 22992805, 25270893, 29771405, 36672844
Skin Diseases	Stimulate	37740179
Sleep Apnea Obstructive	Associate	19218687, 19581829, 20847078, 22761257, 24380782, 26276663, 30001365, 31210414, 32029067, 36824025, 39252231
Sleep Apnea Obstructive	Stimulate	35491659, 37217113
Sleep Deprivation	Associate	23440187
Sleep Deprivation	Stimulate	25451613
Sleep Initiation and Maintenance Disorders	Associate	25535857, 36607882
Sleep Initiation and Maintenance Disorders	Inhibit	25749595
Sleep Wake Disorders	Associate	20400291, 20570482, 24012192, 34135474
Sleepiness	Associate	32029067
Small Cell Lung Carcinoma	Associate	29020964, 31366794
Smoke Inhalation Injury	Stimulate	20057902
Smoke Inhalation Injury	Associate	37084641
Soft Tissue Injuries	Associate	39354444
Soft Tissue Injuries	Stimulate	39513097
Spherocytosis Type 1	Inhibit	34540188
Spinal Cord Diseases	Associate	32717400
Spinal Cord Injuries	Associate	33451043, 33595805
Spondylarthritis	Associate	18311795
Spondylitis Ankylosing	Associate	31953524, 36575020, 36700196, 40305235
Squamous Cell Carcinoma of Head and Neck	Associate	10543258, 10736096, 15847702, 18006755, 21104991, 21187140, 21559372, 21656745, 21710491, 21845339, 22583829, 22912337, 23185547, 24048704, 24398980 View all (29 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	16984731, 19484147, 37391526
Squamous Intraepithelial Lesions	Stimulate	33797568
ST Elevation Myocardial Infarction	Associate	31873176, 33122738, 33273611
Status Asthmaticus	Associate	16670028, 19465513, 23600543, 25985190, 28116321, 31029772, 31047104, 36753209, 8050173
Status Asthmaticus	Stimulate	20816188, 24349168, 26232643, 34335580
Stevens Johnson Syndrome	Stimulate	28011147
Stiff Skin Syndrome	Associate	19066003, 26191285
Still's Disease Adult Onset	Stimulate	30616678
Still's Disease Adult Onset	Associate	30687316, 30755262, 33552062, 33892792, 34127696, 34789453, 37500699, 38124139
Stomach Diseases	Associate	24116074, 25888319, 34008757, 34104107
Stomach Neoplasms	Associate	12760309, 15354212, 15361708, 16769709, 18573283, 21633597, 22126569, 22351606, 22457856, 23117246, 23365642, 24116074, 24460320, 24519125, 24886605 View all (21 more)
Stomach Neoplasms	Stimulate	28851954, 31646814
Stomatitis Aphthous	Stimulate	21478439
Streptococcal Infections	Associate	28176831
Stress Disorders Post Traumatic	Stimulate	30777365
Stroke	Stimulate	20090932, 27409177, 33903586
Stroke	Associate	20622166, 21407237, 22167233, 35503943, 35673992, 38067150
Stroke	Inhibit	24167359
Subarachnoid Hemorrhage	Associate	25125049, 27576738, 29194369
Substance Related Disorders	Stimulate	21148804
Sunburn	Associate	9740223
Sutton disease 2	Associate	26039006, 31937279
Sveinsson Chorioretinal Atrophy	Associate	28434701
Syndrome	Stimulate	17166416
Syndrome	Associate	34757857, 39290705
Synovial Cyst	Associate	10913062, 28807007, 32159845
Synovitis	Associate	21548952
Synovitis Pigmented Villonodular	Associate	35264617
Syphilis	Associate	32532356
Syphilis secondary	Stimulate	28143443
Syphilis secondary	Associate	31930972
Systemic Inflammatory Response Syndrome	Associate	12554901, 14566255, 16276011, 20583924, 33510953, 36012469
Tachycardia Sinoatrial Nodal Reentry	Stimulate	34737220
Takayasu Arteritis	Associate	16802373, 25604533, 28756073, 31315839, 39817309
Tang Hsi Ryu syndrome	Stimulate	33196557
Technophobia	Associate	36852851
Telangiectasis	Stimulate	32621937
Temporomandibular Joint Disorders	Associate	28714016
Temporomandibular Joint Dysfunction Syndrome	Associate	28714016
Tendinopathy	Associate	22337942, 29385715
Tertiary Lymphoid Structures	Stimulate	23185547
Tertiary Lymphoid Structures	Associate	25761055, 27050979
Testicular Diseases	Associate	37033952
Thalassemia	Associate	23905873
Thoracic Injuries	Inhibit	31238711
Thrombocythemia Essential	Associate	26491227
Thrombocytopenia	Associate	31408438, 35488725
Thrombocytopenia	Inhibit	7537110
Thrombocytopenia	Stimulate	7605999
Thrombocytosis	Associate	11432624, 26490522
Thromboinflammation	Associate	34775962
Thrombophilia	Associate	17177164, 34452748
Thrombophilia	Stimulate	35180460
Thrombosis	Associate	20536609, 22914813, 25657311, 25988387, 35180460, 36131342
Thrombosis	Stimulate	21498913
Thrombotic Microangiopathies	Associate	28183278
Thymic epithelial tumor	Associate	16272363
Thymic epithelial tumor	Stimulate	28514756
Thymoma	Associate	30787364, 9630206
Thyroid cancer follicular	Associate	23867310
Thyroid Cancer Papillary	Associate	34628367, 35090515
Thyroid Diseases	Associate	29131274
Thyroid Neoplasms	Associate	23844163, 33247999, 36407322, 37896899, 37960775
Thyroiditis	Inhibit	31350776
Thyroiditis	Stimulate	36159840
Thyroiditis Autoimmune	Associate	1320956, 21235536, 25127106, 2680182, 31552761, 32604892
Thyroiditis Subacute	Associate	7701874
Thyroiditis Suppurative	Associate	36853509
Tinnitus	Associate	26572700, 36401375
Tissue Adhesions	Associate	34968168
Tooth Erosion	Associate	33855071
Tooth Resorption	Associate	17286759, 29521042, 7642293
Torsades de Pointes	Associate	34664888
Toxoplasmosis	Associate	32126572, 34597501
Toxoplasmosis Ocular	Associate	24278490
Trachoma	Associate	27321784
Transposition of Great Vessels	Associate	35590253
Trauma Nervous System	Associate	23840697
Tremor	Inhibit	26090964
Tricuspid Valve Stenosis	Associate	36555139
Trigeminal Neuralgia	Stimulate	34067581
Triple Negative Breast Neoplasms	Stimulate	26513016, 26690867, 35268073, 35964108
Triple Negative Breast Neoplasms	Associate	26752006, 28343970, 31182923, 32920591, 35960749, 37069669, 37199043, 37378935, 37657065, 37713894, 39905567, 40723906
Trypanosomiasis African	Associate	26090964
Tuberculosis	Associate	21303360, 22140472, 22670716, 23486418, 23743311, 26611774, 29888256, 30886421, 32233518, 33720848, 33841412, 35025927, 35305574, 35694534, 36439164, 37653422, 39519346 View all (2 more)
Tuberculosis	Stimulate	23028695, 24327799, 32053511, 35463641
Tuberculosis	Inhibit	31678658
Tuberculosis Lymph Node	Associate	36439164
Tuberculosis Meningeal	Associate	23743311, 26681217, 30696839, 37653422
Tuberculosis Meningeal	Stimulate	32265833
Tuberculosis Multidrug Resistant	Associate	27681197, 34424286
Tuberculosis Pleural	Stimulate	23028695, 9519218
Tuberculosis Pulmonary	Associate	16840026, 25299090, 26840977, 29888256, 32233518, 33099324, 34993731
Tuberculosis Pulmonary	Inhibit	26840977
Tuberculosis Pulmonary	Stimulate	27434276
Tuberculosis Spinal	Associate	29795056
Tuberous Sclerosis	Associate	24606538
Tyrosine Kinase 2 Deficiency	Stimulate	29725107
Ulcer	Associate	15627645, 24618232, 25753878
Uremia	Associate	16760905, 29944162
Urethral Neoplasms	Stimulate	16278308, 25640370
Urinary Bladder Neoplasms	Associate	18825409, 25292079, 29517678, 30310111, 30744595, 32406319, 3495482, 37047238, 38072891, 39456780, 9681394
Urinary Bladder Neoplasms	Stimulate	25640370
Urinary Tract Infections	Associate	20526368
Urogenital Diseases	Stimulate	33149212
Urolithiasis	Inhibit	37878647
Urolithiasis	Associate	37878647
Urologic Diseases	Associate	21191629
Urticaria	Associate	23207551, 26774658, 29410184
Urticaria	Stimulate	36539847
Uterine Cervical Dysplasia	Associate	39684873
Uterine Cervical Neoplasms	Associate	10366571, 10925276, 12801265, 16803517, 19404917, 20565840, 23099807, 23587428, 25227842, 26474968, 27220278, 27690342, 27722983, 27866212, 27883176 View all (8 more)
Uterine Cervical Neoplasms	Stimulate	31396215
Uterine Cervicitis	Stimulate	19046168
Uterine Cervicitis	Associate	30547901, 8098584
Uterine Diseases	Associate	16989825, 35279667
Uterine Neoplasms	Associate	15785748
Uveal melanoma	Associate	22429778, 29899166, 32957329, 33682883, 35163491
Uveitis	Associate	27028890
Uveitis	Stimulate	32479651, 33639877, 35061677
Uveitis Intermediate	Associate	26640809
Uveomeningoencephalitic Syndrome	Stimulate	25303043
Uveomeningoencephalitic Syndrome	Associate	26818976, 33384687
Vaginitis	Stimulate	23375395
Vaginosis Bacterial	Associate	18485781
Varicella Zoster Virus Infection	Inhibit	23884823
Varicella Zoster Virus Infection	Associate	30835269
Varicocele	Associate	31006709, 36372090
Varicose Veins	Associate	25899133, 32679199
Vascular Calcification	Stimulate	34767831
Vascular Calcification	Associate	36930472
Vascular Diseases	Associate	16566827, 17596140, 18069022, 20385468, 23364322, 33383381, 37327001
Vascular Remodeling	Associate	32029443
Vasculitis	Associate	36453709, 36794867
Vasospasm Intracranial	Associate	25125049, 25269057
Vasospasm Intracranial	Stimulate	29194369
Venous Insufficiency	Associate	29439934
Venous Thromboembolism	Associate	26238017, 35625609
Venous Thrombosis	Associate	29890913, 35625609, 38215128
Ventricular Dysfunction Left	Associate	31379862, 40088950
Ventricular Dysfunction Left	Stimulate	31533725
Ventricular Fibrillation	Associate	26864064
Ventricular Remodeling	Associate	15298045
Virus Diseases	Associate	14711802, 1592439, 21880131, 25899133, 26790609, 30808838, 33746945, 34233673, 34634929, 35165525, 39354444
Virus Diseases	Stimulate	32603902, 34076157
Vitiligo	Stimulate	22696056, 40723924
Vitiligo	Associate	23555779, 26177100, 9077486
Vitreoretinopathy Proliferative	Stimulate	28572674
Vitreoretinopathy Proliferative	Associate	29246578, 39486365
Waldenstrom Macroglobulinemia	Associate	16804116, 21921047, 29496671, 30104397, 30279229, 32763516, 33690107, 33764527
Wasting Syndrome	Associate	20583924
Weight Gain	Associate	16493118, 27399105
Weight Loss	Associate	16840032, 28555011, 34502316, 34883250
Weight Loss	Inhibit	18356846, 18579536, 28797697
West Nile Fever	Stimulate	33671821
Wolffian tumor	Associate	30336198
Wolfram Syndrome	Associate	33693650
Wounds and Injuries	Associate	23423626, 24034344, 31417126
Wounds and Injuries	Stimulate	31207479, 32769953
Wounds and Injuries	Inhibit	33484391
Wrist Fractures	Associate	15355555
X Linked Combined Immunodeficiency Diseases	Associate	15550378
Xanthomatosis	Stimulate	16083882
Xeroderma Pigmentosum	Associate	10998144, 11710926
Yellow Fever	Stimulate	19906894
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	18615482

IL6 (interleukin 6)