IL4I1 (interleukin 4 induced 1)

Gene

• Entrez ID: 259307
• Gene name: Interleukin 4 induced 1
• Gene symbol: IL4I1
• Synonyms (NCBI Gene): FIG1, LAAO, LAO, hIL4I1
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a secreted L-amino acid oxidase protein which primarily catabolizes L-phenylalanine and, to a lesser extent, L-arginine. The expression of this gene is induced by the cytokine interleukin 4 in B cells. This gene is also expressed in macr

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IDA	25767141
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001716	Function	L-amino-acid oxidase activity	IBA
GO:0001716	Function	L-amino-acid oxidase activity	IDA	17356132, 25767141, 26673964, 32818467, 32866000
GO:0001716	Function	L-amino-acid oxidase activity	IEA
GO:0001772	Component	Immunological synapse	IDA	28891065
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002819	Process	Regulation of adaptive immune response	IDA	17356132
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	32818467
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	IDA	17356132, 32818467
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0006559	Process	L-phenylalanine catabolic process	IDA	17356132, 25767141
GO:0006569	Process	L-tryptophan catabolic process	IDA	17356132, 25767141
GO:0006572	Process	L-tyrosine catabolic process	IDA	17356132
GO:0009063	Process	Amino acid catabolic process	IBA
GO:0009072	Process	Aromatic amino acid metabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019440	Process	L-tryptophan catabolic process to indole-3-acetate	IDA	32818467, 32866000
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	17356132
GO:0045577	Process	Regulation of B cell differentiation	ISS
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IDA	25778793
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	32818467
GO:0050868	Process	Negative regulation of T cell activation	IDA	28891065
GO:0097225	Component	Sperm midpiece	IDA	25767141
GO:0106329	Function	L-phenylalaine oxidase activity	IEA

Other IDs

• MIM: 609742
• HGNC: 19094
• e!Ensembl: ENSG00000104951

Protein

• UniProt ID: Q96RQ9
• Protein name: L-amino-acid oxidase (LAAO) (LAO) (EC 1.4.3.2) (EC 1.4.3.25) (Interleukin-4-induced protein 1) (IL4-induced protein 1) (hIL4I1) (Protein Fig-1) (hFIG1)
• Protein function: Secreted L-amino-acid oxidase that acts as a key immunoregulator (PubMed:17356132, PubMed:32818467, PubMed:32866000). Has preference for L-aromatic amino acids: converts phenylalanine (Phe), tyrosine (Tyr) and tryptophan (Trp) to phenylpyruvic a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01593	Amino_oxidase	69 → 505	Flavin containing amine oxidoreductase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Primarily found in immune tissues, with the highest expression in lymph nodes and spleen (PubMed:12031486, PubMed:12446450). Present in germinal center macrophages and inflammatory myeloid cells and antigen-presenting cells (at protein
• Sequence:

  MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQ
  RVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSS
  HRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPE
  DIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFY
  LSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVHVQ
  IETSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYVPATKVFLSFR
  RPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLAL
  DDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAG
  EHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHD
  LAKEEGSHPPVQGQLSLQNTTHTRTSH

• Sequence length: 567