Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3553
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 1 beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL1B
Synonyms (NCBI Gene) Gene synonyms aliases	IL-1, IL1-BETA, IL1F2, IL1beta
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an impo

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1143627	G>A	Risk-factor	5 prime UTR variant, upstream transcript variant, genic upstream transcript variant

Show/Hide all(132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005830	hsa-miR-204-5p	Microarray	21282569
MIRT005951	hsa-miR-21-5p	Luciferase reporter assay, Microarray, qRT-PCR	21131358
MIRT733144	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733149	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT733150	hsa-let-7c-5p	qRT-PCR	31766503
MIRT734896	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949
MIRT735074	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR, ELISA	33201565
MIRT735665	hsa-miR-340-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32712318
MIRT733150	hsa-let-7c-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	34198264
MIRT735818	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755648	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38146363
MIRT755847	hsa-miR-105-5p	qRT-PCR	34824551
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2247568	hsa-miR-3942-3p	CLIP-seq
MIRT2247569	hsa-miR-4670-3p	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550936	hsa-miR-1178	CLIP-seq
MIRT2437793	hsa-miR-124	CLIP-seq
MIRT2437794	hsa-miR-1256	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2437795	hsa-miR-185	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2437796	hsa-miR-2682	CLIP-seq
MIRT2550940	hsa-miR-299-3p	CLIP-seq
MIRT2437797	hsa-miR-3064-5p	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550942	hsa-miR-3121-3p	CLIP-seq
MIRT2437798	hsa-miR-3134	CLIP-seq
MIRT2437799	hsa-miR-3147	CLIP-seq
MIRT2437800	hsa-miR-3160-3p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2437802	hsa-miR-3714	CLIP-seq
MIRT2437803	hsa-miR-3910	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2437804	hsa-miR-3945	CLIP-seq
MIRT2437805	hsa-miR-4253	CLIP-seq
MIRT2437806	hsa-miR-4259	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2550947	hsa-miR-4300	CLIP-seq
MIRT2437807	hsa-miR-4306	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2437809	hsa-miR-4428	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2437810	hsa-miR-449c	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2437811	hsa-miR-4514	CLIP-seq
MIRT2437812	hsa-miR-4520a-3p	CLIP-seq
MIRT2437813	hsa-miR-4534	CLIP-seq
MIRT2437814	hsa-miR-4644	CLIP-seq
MIRT2550953	hsa-miR-4645-5p	CLIP-seq
MIRT2550954	hsa-miR-4648	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550956	hsa-miR-4654	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550958	hsa-miR-4673	CLIP-seq
MIRT2247570	hsa-miR-4683	CLIP-seq
MIRT2437815	hsa-miR-4692	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2437816	hsa-miR-4766-5p	CLIP-seq
MIRT2437817	hsa-miR-4768-3p	CLIP-seq
MIRT2550961	hsa-miR-4769-5p	CLIP-seq
MIRT2437818	hsa-miR-488	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2437819	hsa-miR-506	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq
MIRT2550965	hsa-miR-920	CLIP-seq
MIRT2437820	hsa-miR-940	CLIP-seq
MIRT2437821	hsa-miR-943	CLIP-seq
MIRT2550937	hsa-miR-1291	CLIP-seq
MIRT2550938	hsa-miR-149	CLIP-seq
MIRT2550939	hsa-miR-24	CLIP-seq
MIRT2550941	hsa-miR-3065-5p	CLIP-seq
MIRT2550943	hsa-miR-3174	CLIP-seq
MIRT2550944	hsa-miR-328	CLIP-seq
MIRT1064204	hsa-miR-3682-5p	CLIP-seq
MIRT2437801	hsa-miR-3684	CLIP-seq
MIRT2550945	hsa-miR-3937	CLIP-seq
MIRT2550946	hsa-miR-4284	CLIP-seq
MIRT2437808	hsa-miR-4313	CLIP-seq
MIRT2550948	hsa-miR-4446-3p	CLIP-seq
MIRT2550949	hsa-miR-4450	CLIP-seq
MIRT2550950	hsa-miR-4492	CLIP-seq
MIRT2550951	hsa-miR-4498	CLIP-seq
MIRT2550952	hsa-miR-4505	CLIP-seq
MIRT2550955	hsa-miR-4652-3p	CLIP-seq
MIRT2550957	hsa-miR-4667-5p	CLIP-seq
MIRT2550959	hsa-miR-4700-5p	CLIP-seq
MIRT2550960	hsa-miR-4731-5p	CLIP-seq
MIRT2550962	hsa-miR-495	CLIP-seq
MIRT2550963	hsa-miR-663b	CLIP-seq
MIRT2550964	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(23)

Transcription factor	Regulation	Reference
AHR	Unknown	23349129
CEBPB	Activation	17386941
CEBPB	Unknown	10383163;10801783
E2F1	Unknown	17707233
HMGA1	Unknown	15901130
HSF1	Repression	10328874
IRF8	Activation	17386941
JUN	Unknown	11306276
JUNB	Unknown	11306276
KLF4	Repression	22449968
NFIL3	Repression	8547328
NFKB1	Activation	12686724;14960579;8413223;8679226;9878621
NFKB1	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
NFKBIA	Repression	15228586
REL	Activation	8413223
RELA	Activation	12686724;14960579;8021507;8413223;8679226;9878621
RELA	Unknown	10080875;10963848;16433741;17707233;18285351;20336759;9058643
SIRT1	Unknown	21245135
SPI1	Activation	17386941
SPI1	Unknown	10801783
STAT1	Activation	17386941
SUGP1	Activation	9878621
YY1	Unknown	22467534

Show/Hide all(116)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IMP	21147091
GO:0000187	Process	Activation of MAPK activity	IDA	10748004
GO:0001660	Process	Fever generation	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	10748004
GO:0001934	Process	Positive regulation of protein phosphorylation	NAS	16477012
GO:0002711	Process	Positive regulation of T cell mediated immunity	IC	1919436
GO:0005125	Function	Cytokine activity	IDA	1919436
GO:0005125	Function	Cytokine activity	IMP	2989698
GO:0005125	Function	Cytokine activity	TAS	28720735
GO:0005149	Function	Interleukin-1 receptor binding	NAS	1919436
GO:0005178	Function	Integrin binding	IDA	29030430
GO:0005515	Function	Protein binding	IPI	15817483, 32272059
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	NAS	1919436
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12483741
GO:0005615	Component	Extracellular space	IMP	3493774
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	TAS	9218611
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	IDA	10748004, 21147091
GO:0006954	Process	Inflammatory response	NAS	1919436
GO:0006954	Process	Inflammatory response	TAS	28720735
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9218611, 10786823
GO:0007267	Process	Cell-cell signaling	TAS	2989698
GO:0007566	Process	Embryo implantation	TAS	16720713
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25204733
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	3493774
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	12958148
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IDA	11090614, 21559518, 23817958, 25327529, 26687115, 29384235
GO:0010628	Process	Positive regulation of gene expression	IGI	29384235
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	25204733
GO:0010829	Process	Negative regulation of glucose transmembrane transport	ISS	16865359
GO:0014805	Process	Smooth muscle adaptation	NAS	16477012
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	10748004
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019904	Function	Protein domain specific binding	IPI	16575408
GO:0030213	Process	Hyaluronan biosynthetic process	IDA	15100360
GO:0030335	Process	Positive regulation of cell migration	IDA	25204733
GO:0030730	Process	Sequestering of triglyceride	IDA	19032770
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IC	12958148
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IGI	29384235
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	21147091
GO:0032308	Process	Positive regulation of prostaglandin secretion	ISS
GO:0032496	Process	Response to lipopolysaccharide	IDA	19193853
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	10653850, 20027291
GO:0032743	Process	Positive regulation of interleukin-2 production	IMP	2989698
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	29384235
GO:0032755	Process	Positive regulation of interleukin-6 production	TAS	16865359
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IBA	21873635
GO:0033129	Process	Positive regulation of histone phosphorylation	NAS	20018936
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	15100360
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	NAS	19281832
GO:0035066	Process	Positive regulation of histone acetylation	NAS	20018936
GO:0035505	Process	Positive regulation of myosin light chain kinase activity	IDA	18390750
GO:0035690	Process	Cellular response to drug	IDA	19158679
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	1919436
GO:0043122	Process	Regulation of I-kappaB kinase/NF-kappaB signaling	IDA	10748004
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS	16865359
GO:0043491	Process	Protein kinase B signaling	IMP	21147091
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	8383325
GO:0045766	Process	Positive regulation of angiogenesis	IDA	25204733
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045833	Process	Negative regulation of lipid metabolic process	ISS	16865359
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	2989698
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	15100360
GO:0045917	Process	Positive regulation of complement activation	IGI	29384235
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS	16865359
GO:0046827	Process	Positive regulation of protein export from nucleus	NAS	19281832
GO:0050729	Process	Positive regulation of inflammatory response	IGI	29384235
GO:0050766	Process	Positive regulation of phagocytosis	IMP	18201371
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0050768	Process	Negative regulation of neurogenesis	TAS	20018408
GO:0050796	Process	Regulation of insulin secretion	IDA	8383325
GO:0050805	Process	Negative regulation of synaptic transmission	ISS
GO:0050995	Process	Negative regulation of lipid catabolic process	IDA	19032770
GO:0050996	Process	Positive regulation of lipid catabolic process	ISS	16865359
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IBA	21873635
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IDA	15899045
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	18373975
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10748004
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10383454, 12958148, 25327529
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IGI	1752215
GO:0060355	Process	Positive regulation of cell adhesion molecule production	NAS	19281832
GO:0060559	Process	Positive regulation of calcidiol 1-monooxygenase activity	IDA	16720713, 17023519
GO:0070164	Process	Negative regulation of adiponectin secretion	ISS	16865359
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	25204733
GO:0070487	Process	Monocyte aggregation	IDA	15100360
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	25327529
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070555	Process	Response to interleukin-1	IDA	29441883
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071310	Process	Cellular response to organic substance	IDA	19158679
GO:0071407	Process	Cellular response to organic cyclic compound	IDA	21147091
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900745	Process	Positive regulation of p38MAPK cascade	ISS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	18390750
GO:1902680	Process	Positive regulation of RNA biosynthetic process	IDA	29384235
GO:1903140	Process	Regulation of establishment of endothelial barrier	IDA	25816133
GO:1903597	Process	Negative regulation of gap junction assembly	IDA	11090614
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10748004

MIM	HGNC	e!Ensembl
147720	5992	ENSG00000125538

Protein

UniProt ID

P01584

Protein name

Interleukin-1 beta (IL-1 beta) (Catabolin)

Protein function

Potent pro-inflammatory cytokine (PubMed:10653850, PubMed:12794819, PubMed:28331908, PubMed:3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and

PDB

1HIB , 1I1B , 1IOB , 1ITB , 1L2H , 1S0L , 1T4Q , 1TOO , 1TP0 , 1TWE , 1TWM , 21BI , 2I1B , 2KH2 , 2NVH , 31BI , 3LTQ , 3O4O , 3POK , 41BI , 4DEP , 4G6J , 4G6M , 4GAF , 4GAI , 4I1B , 5BVP , 5I1B , 5MVZ , 5R7W , 5R85 , 5R86 , 5R87 , 5R88 , 5R89 , 5R8A , 5R8B , 5R8C , 5R8D , 5R8E , 5R8F , 5R8G , 5R8H , 5R8I , 5R8J , 5R8K , 5R8L , 5R8M , 5R8N , 5R8O , 5R8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02394	IL1_propep	1 → 103	Interleukin-1 propeptide	Family
PF00340	IL1	147 → 264	Interleukin-1 / 18	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in activated monocytes/macrophages (at protein level). {ECO:0000269|PubMed:15192144}.

Sequence

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS

Sequence length

269

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Gastric Cancer	hereditary diffuse gastric adenocarcinoma	Furthermore, GC cells growth was significantly inhibited after the down-regulation of METTL1 in vitro and in vivo.	GenCC, CBGDA
Endometriosis	Endometriosis		GWAS

Show/Hide Text Mining Associations (1184)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	15257727, 35615856
AA amyloidosis	Stimulate	34218796
Abortion Habitual	Stimulate	26474737, 29665864, 9093132
Abortion Habitual	Associate	29017513
Abortion Spontaneous	Associate	35090453
Abortion Spontaneous	Stimulate	39408839
Acanthamoeba Keratitis	Associate	33755043
Accessory Nerve Injuries	Associate	35892263
Achlorhydria	Associate	10746728, 16120761, 17453104
Acidemia isovaleric	Associate	20690185, 25510775, 27391542
Acne Vulgaris	Associate	23884315, 25153527
Acquired Immunodeficiency Syndrome	Associate	1693429, 24939850, 32532356, 7511077, 8815158
Acquired Immunodeficiency Syndrome	Stimulate	26475133
Acute Coronary Syndrome	Associate	18299273, 26304941
Acute Coronary Syndrome	Stimulate	25591771
Acute Disease	Stimulate	24696530
Acute Kidney Injury	Associate	20805419
Acute Kidney Injury	Stimulate	29238179
Acute Lung Injury	Associate	18065658, 31754335, 32720541
Acute On Chronic Liver Failure	Associate	17177978, 30911280, 31628069, 34774066
Acute On Chronic Liver Failure	Stimulate	34551597
Adenocarcinoma	Associate	19055699, 31635541, 34818353, 35328735
Adenocarcinoma Bronchiolo Alveolar	Associate	38016030
Adenocarcinoma of Lung	Associate	37798663, 37985999, 38614857
Adenoma	Associate	24859972, 30598580
Adenomatous Polyps	Associate	37404119
Adrenal Hyperplasia Congenital	Associate	26657940
adult multisystem inflammatory disease COVID 19 related	Associate	24773462
adult multisystem inflammatory disease COVID 19 related	Stimulate	36102684
Aggressive Periodontitis	Associate	18587204, 20447254
AIDS Associated Nephropathy	Associate	20336759, 31238091
AIDS Dementia Complex	Associate	18453587, 24625401
Albuminuria	Associate	21054877
Albuminuria	Stimulate	21054877
Alcohol Related Disorders	Associate	32495042
Alcoholism	Associate	21176217
Alcoholism	Stimulate	26747782
Allan Herndon Dudley syndrome	Stimulate	24768357
Allergic Fungal Sinusitis	Associate	33928889, 36094193
Alopecia Areata	Stimulate	28266599
Alopecia Areata	Associate	7930677
Altitude Sickness	Associate	32033172
Alveolitis Extrinsic Allergic	Associate	37833889
Alzheimer Disease	Associate	10716257, 12050157, 15201366, 15377701, 17563722, 18830724, 20184726, 21368376, 21509504, 21992747, 22498095, 22832605, 23199001, 24359497, 25197660 View all (16 more)
Alzheimer Disease	Stimulate	11483667, 21741294, 30741672, 37679689, 38599243
Amyloidosis	Associate	25438464
Amyloidosis Hereditary Transthyretin Related	Stimulate	31253122
Amyotrophic Lateral Sclerosis	Associate	28437540, 32246039, 35627142
Amyotrophic lateral sclerosis 1	Associate	21062492
Androgen Insensitivity Syndrome	Stimulate	25860946
Anemia	Associate	37934948
Anemia Hemolytic	Associate	23451225
Anemia Hemolytic	Stimulate	3264697
Anemia Sickle Cell	Associate	11001897, 33776989, 34627079, 36969226
Anemia Sickle Cell	Stimulate	24551209, 25548984, 33741688
Aneurysm	Associate	35909487
Aneurysm Ascending Aorta	Associate	34202072
Angina Stable	Associate	29554212
Angina Stable	Stimulate	31257469, 35942210
Angina Unstable	Stimulate	10475771
Angina Unstable	Associate	18299273
Angioedemas Hereditary	Associate	31236065
Ankle Fractures	Stimulate	29940605, 30237391
Ankle Injuries	Stimulate	28742210
Anodontia	Associate	37894839
Anterior Cruciate Ligament Injuries	Associate	26762166
Anthropophobia	Associate	33936110, 37031355
Anti N Methyl D Aspartate Receptor Encephalitis	Stimulate	30418472, 36544777
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	26149790, 8455368
Antiphospholipid Syndrome	Associate	25785264
Anxiety	Associate	25249351, 26891860, 28413930, 30504920, 32377159
Anxiety Disorders	Associate	32377159
Aortic Aneurysm	Associate	34202072
Aortic Aneurysm Abdominal	Associate	17321344, 24618883
Aortic Aneurysm Abdominal	Stimulate	20348247
Aortic Aneurysm Thoracic	Associate	37445606
Aortic Valve Insufficiency	Stimulate	34935306
Aortic Valve Stenosis	Stimulate	21241861
Aortic Valve Stenosis	Associate	23735716
Appendicitis	Associate	24336024
Arachnoid Cysts	Associate	31743616
Arteriosclerosis	Associate	3491091, 3526909
Arthritis	Associate	11714393, 16846531, 18346273, 2156847, 21835002, 22687048, 26577823, 30131320, 35095831
Arthritis	Stimulate	17393419, 33480001
Arthritis Gouty	Associate	23738004, 26462562, 28458315, 28797095, 28915828, 29214547
Arthritis Gouty	Stimulate	35470716
Arthritis Infectious	Inhibit	18945879, 7858264
Arthritis Infectious	Associate	20740673
Arthritis Juvenile	Associate	15851489, 17324969, 18576390, 19248102, 22281427, 28286780, 29928998, 31958219, 33452871, 34257378
Arthritis Juvenile	Stimulate	28935693
Arthritis Psoriatic	Associate	10857783, 11714393, 11851889, 16918024, 22509827, 29434599, 33300400, 38124740, 7693825, 8245502
Arthritis Psoriatic	Stimulate	16728461, 19661441, 27542294, 28245522
Arthritis Reactive	Associate	10524675
Arthritis Rheumatoid	Associate	10366101, 10976082, 11083259, 11168012, 11171698, 11219391, 11219394, 11406522, 11714393, 11966774, 12115161, 12139733, 12528110, 12571842, 12632414 View all (93 more)
Arthritis Rheumatoid	Stimulate	10733472, 12810425, 14680510, 15972956, 16728461, 22275154, 24351865, 25164131, 26095630, 26339358, 28245522, 3264697, 32868411, 34290266, 35470716, 35955467, 37202736, 37386795 View all (3 more)
Arthritis Rheumatoid	Inhibit	12296865
Ascites	Inhibit	21203522
Ascites	Associate	25080058, 34887625
Asphyxia	Associate	29931509
Asthma	Associate	11704539, 16203992, 18492738, 18774390, 18780949, 19473523, 19710636, 24136334, 24654313, 25616863, 28011059, 30998987, 32842623, 32900903, 33506909 View all (4 more)
Asthma	Inhibit	19842845
Asthma	Stimulate	24641287, 27155035, 31903716, 33515711, 35572500
Astrocytoma	Associate	10037734, 12767055, 17121800, 18297103, 40565357
Astrocytoma	Stimulate	22818222, 2646146
Ataxia	Associate	32554850
Ataxia Telangiectasia	Associate	32554850
Atherosclerosis	Associate	10590238, 10790428, 15383152, 16613759, 17351655, 19092239, 19347053, 19574724, 20184726, 20805419, 22768033, 23484124, 24063019, 24190014, 24665821 View all (21 more)
Atherosclerosis	Stimulate	20637088
Atrial Fibrillation	Stimulate	29595637
Atrial Fibrillation	Associate	32383373, 38551417
Atrioventricular Septal Defect	Associate	27396555
Atrophy	Associate	16120761, 23995914
Autism Spectrum Disorder	Associate	19211157, 23497090, 26392128, 27957319, 31554204, 32129578, 39481220
Autism Spectrum Disorder	Stimulate	32677958
Autoimmune Diseases	Associate	11127488, 11380474, 15192144, 16380445, 19793334, 20498357, 23382179, 24890729, 30761138, 30894604, 30902060, 33776573
Autoimmune Diseases of the Nervous System	Associate	36929812
Axial Spondyloarthritis	Associate	26178906
Azoospermia	Stimulate	39712014
Bacterial Infections	Inhibit	12853386
Bacterial Infections	Associate	28233860, 34925324, 39269158
Bacterial Infections	Stimulate	8500890
Barrett Esophagus	Associate	11889061, 26688097, 35328735
Behcet Syndrome	Associate	24105615, 28166214, 36226612
Behcet Syndrome	Stimulate	24135410, 24749687, 33957967
beta Thalassemia	Associate	29947343
Bipolar Disorder	Associate	19125864, 19488045, 33348197, 33667413
Bipolar Disorder	Stimulate	26257203, 30575805
Bipolar Disorder	Inhibit	29032575
Birdshot Chorioretinopathy	Associate	18941541
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blast Injuries	Stimulate	36508265
Blau syndrome	Associate	25829188
Blood Coagulation Disorders	Associate	20417488, 31416821
Bone Diseases	Associate	10050719, 11600466, 20935210, 21401926, 28682145, 33605409, 9864174
Bone Diseases	Stimulate	15287939
Bone Diseases Metabolic	Associate	11600466
Bone Marrow Diseases	Associate	9886334
Bone Resorption	Associate	9807705
Brachydactyly Type D	Stimulate	28504607
Brain Abscess	Associate	17989372
Brain Diseases	Stimulate	26166618, 9143252
Brain Diseases	Associate	26661157
Brain Edema	Associate	17335802
Brain Injuries	Stimulate	29931509
Brain Injuries Traumatic	Associate	21676422, 30596792, 31173307
Brain Ischemia	Inhibit	30539420
Brain Ischemia	Associate	9207638
Breast Neoplasms	Associate	12201223, 15187102, 16464738, 17261184, 17385677, 17670913, 21057224, 21310944, 21486440, 23083134, 23378578, 23530106, 23991131, 24670917, 25928089 View all (26 more)
Breast Neoplasms	Stimulate	20418110, 32244518, 38263420
Bronchial Hyperreactivity	Associate	23737648
Bronchiectasis	Stimulate	10515411
Bronchiolitis	Stimulate	24750386, 36561744
Bronchiolitis Obliterans Syndrome	Stimulate	24750386, 26717145
Bronchiolitis Obliterans Syndrome	Associate	33078555
Bronchopulmonary Dysplasia	Associate	30969811
Brucellosis	Stimulate	20404074
Burkitt Lymphoma	Stimulate	9878621
Burning Mouth Syndrome	Associate	16942951
Burns	Inhibit	23896833
Burns	Stimulate	24584061
Bursitis	Associate	21484857, 28676856
Bursitis	Stimulate	28676856
Cachexia	Associate	11076651, 17359523, 33047901
Calcinosis	Associate	36610524
Calcinosis	Inhibit	36780769
Calcinosis	Stimulate	39313278
Carcinogenesis	Associate	16610058, 16884377, 19904560, 20473875, 21988351, 23359190, 23383347, 23935506, 23995914, 24878968, 26158864, 27340011, 30010986, 31222982, 35395492, 36674955 View all (1 more)
Carcinoma Basal Cell	Associate	12081561
Carcinoma Basal Cell	Stimulate	31031757
Carcinoma Ductal Breast	Associate	23083134
Carcinoma Hepatocellular	Associate	12651617, 15196593, 15967798, 16521194, 1660018, 17054948, 20467172, 21512226, 22302133, 24966965, 26757951, 27821810, 28427195, 29568203, 29802240 View all (10 more)
Carcinoma Hepatocellular	Stimulate	34435646
Carcinoma Intraductal Noninfiltrating	Associate	21486440
Carcinoma Non Small Cell Lung	Associate	19138976, 22923190, 25597281, 26439031, 31941995, 32851926, 34440860, 37441079, 37550397, 38103126
Carcinoma Ovarian Epithelial	Associate	34638541
Carcinoma Pancreatic Ductal	Associate	24884871, 29224225, 35395492, 37914939, 38018872, 39260693, 39273323
Carcinoma Renal Cell	Associate	1739130, 23342250, 24969107, 26323562, 32469992, 34433833, 35257717, 7656270
Carcinoma Renal Cell	Stimulate	18294286, 24768357
Carcinoma Squamous Cell	Stimulate	12171950
Carcinoma Squamous Cell	Associate	22450746, 23383347
Carcinoma Transitional Cell	Associate	1739130
Cardiac form of generalized glycogenosis	Associate	31057540
Cardiomyopathies	Associate	26323562, 31057540
Cardiomyopathy Dilated	Associate	18654018, 38551417
Cardiomyopathy Dilated	Stimulate	34713710
Cardiomyopathy Hypertrophic	Associate	22447464
Cardiomyopathy Right Ventricular Dilated	Associate	24247107
Cardiovascular Diseases	Associate	24086545, 26516624, 28105927, 32658258, 33172487, 34667241, 36012132, 36035865, 37821269
Carotid Artery Diseases	Associate	35008765, 36316672
Carotid Stenosis	Associate	25441669, 26195278, 32927275
Carotid Stenosis	Stimulate	33319833
Cartilage Diseases	Associate	10806046, 12810425, 15641077, 17097317, 18205922, 20955562, 21352802, 21682898, 21854562, 22249478, 23241445, 24034344, 24211233, 24831018, 24857974 View all (16 more)
Cartilage Diseases	Stimulate	28692119, 29444596, 29483929, 30219053, 34990303, 36859270
Castleman Disease	Associate	1954381, 34686774
Cataract	Associate	39959181
Celiac Disease	Associate	35216089, 37047806, 37455655
Celiac Disease	Stimulate	35354862
Cell Transformation Neoplastic	Associate	32778144, 37196632
Cerebral Hemorrhage	Associate	27730688, 35833818
Cerebral Infarction	Associate	24063019, 24782217, 26592822, 31183363, 31480765, 32223966, 32782321, 35856366, 35862251, 36089763, 37268894
Cerebral Infarction	Stimulate	33378050, 33678651, 36089763
Cerebral Intraventricular Hemorrhage	Associate	28664278
Cerebral Palsy	Associate	29931509
Cerebrovascular Disorders	Associate	30664615
Chagas Disease	Associate	31057540
Chanarin Dorfman Syndrome	Stimulate	39307292
Chemical and Drug Induced Liver Injury	Associate	16610058, 25080058, 34076990
Chlamydial Pneumonia	Stimulate	15557648
Chlamydophila Infections	Associate	11527622
Cholangiocarcinoma	Associate	18069763, 37507547
Cholangitis Sclerosing	Associate	11413121
Cholestasis	Associate	35196362
Cholesteatoma	Associate	33627146, 36837507
Chondrosarcoma	Associate	24472657, 24901233, 25823818
Chondrosarcoma	Stimulate	27548143, 30380653
Chorioamnionitis	Associate	17003486, 17940116, 28122480, 33976432, 35762614
Chorioamnionitis	Stimulate	25616398, 31912179
Choroidal Effusions	Associate	33977746, 39390512
Chronic Disease	Associate	15257727, 30894604, 31586435, 33246119, 35964023, 7790026, 8325995
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	25798846
Chronic Kidney Disease Mineral and Bone Disorder	Associate	36799882
Chronic Periodontitis	Associate	15664906, 18541658, 21198766, 22124068, 23592003, 24612355, 24690098, 25098998, 25530681, 25710474, 28341818, 30760334, 30922293, 33869630
Chronic Periodontitis	Inhibit	16428799
Chronic Periodontitis	Stimulate	28341818, 33638191
Chronic recurrent multifocal osteomyelitis	Associate	25061439
Chronic Urticaria	Associate	35371000
Cicatrix	Stimulate	22038912
Cicatrix	Associate	25970613
Ciliary Discoordination Due To Random Ciliary Orientation	Associate	32532356
Ciliary Motility Disorders	Associate	29116124
Cleft Palate	Stimulate	35262594
Cognition Disorders	Stimulate	36455873
Cognitive Dysfunction	Associate	23199001, 29196629, 35950445
Coinfection	Stimulate	30679661
Cold Injury	Associate	18668591
Colitis	Associate	29922282
Colitis Associated Neoplasms	Associate	38187473
Colitis Ulcerative	Associate	1427374, 20509889, 21129005, 26530134, 32871953, 33299870, 33359089, 33409535, 34717557, 35876170, 37078344, 38070204, 7586694, 9737666
Colitis Ulcerative	Stimulate	18160345, 30029674, 30369485, 30583612, 31584460, 39647286, 9099934, 9414973
Colonic Neoplasms	Associate	15063730, 17394066, 23174018, 30563955, 36127676, 37274872
Colonic Polyps	Associate	38297356
Colorectal Neoplasms	Associate	10408390, 15188028, 19701245, 23174018, 24194923, 24859972, 25745771, 26075243, 26208990, 27264420, 28157220, 29096354, 29188362, 29719581, 30563955 View all (9 more)
Colorectal Neoplasms	Stimulate	22415590, 25875151, 32947866, 33832346
Colorectal Neoplasms	Inhibit	33236127
Communicable Diseases	Associate	24434549, 32532356
Communication Disorders	Associate	35052452
Congenital Abnormalities	Associate	31434236
Conjunctivitis Allergic	Stimulate	26989694
Constipation	Associate	33717115
Conversion Disorder	Associate	31992083
Corneal Diseases	Stimulate	1951636
Corneal Endothelial Cell Loss	Stimulate	35734851
Corneal Neovascularization	Associate	30156862
Corneal Ulcer	Associate	23750216
Coronary Artery Disease	Associate	11527622, 17827818, 20184726, 20206549, 22738689, 22780915, 24244322, 24699044, 24736319, 25551602, 26304941, 26505399, 26926996, 29067980, 30961613 View all (6 more)
Coronary Artery Disease	Stimulate	30333306, 30392493, 33029103, 33504180, 33731531
Coronary Disease	Associate	27461004, 29121163, 33660877, 34850451, 34861059, 34873417, 35282820
Coronary Disease	Inhibit	39344313
Coronary Restenosis	Stimulate	25253465
Coronavirus Infections	Associate	34281182
Cough	Associate	35866040, 39465738
COVID 19	Associate	32532356, 32592406, 32962703, 33052054, 33138195, 33248385, 33544720, 33662681, 33751722, 33832291, 34020127, 34133077, 34253708, 34450402, 34463916 View all (30 more)
COVID 19	Stimulate	32651212, 32698440, 33129099, 33798476, 34436630, 34673905, 34784300, 34804033, 34831403, 35587188, 36100803, 36121927, 37389217, 37515295
COVID 19	Inhibit	34718118, 38179046
Craniocerebral Trauma	Inhibit	17881264
Craniocerebral Trauma	Associate	26120586, 8610106
Creutzfeldt Jakob Syndrome	Stimulate	23816234
Critical Illness	Associate	33780352
Crohn Disease	Associate	10389698, 16186640, 18157816, 20509889, 21129005, 21228771, 21797848, 26215868, 28166214, 29408806, 29517712, 29521042, 31694333, 33767696, 34629811 View all (5 more)
Crohn Disease	Stimulate	18160345, 23658649, 30583612, 9414973
Cross Infection	Stimulate	11687457, 27015534
Cryopyrin Associated Periodic Syndromes	Associate	15476236, 15541451, 16899778, 17320940, 17763411, 18668591, 19180500, 21356079, 23226210, 24773462, 25217959, 25730877, 25883259, 26161132, 26245468 View all (6 more)
Cryopyrin Associated Periodic Syndromes	Stimulate	20445104, 25596455, 35616535
Cyclic neutropenia	Associate	37934948
Cystic Disease Of Lung	Associate	19431193, 24853301
Cystic Fibrosis	Stimulate	10515411, 24098711, 24885494, 31532390
Cystic Fibrosis	Associate	12221127, 12507912, 18815075, 19431193, 21658316, 21731057, 22649552, 28982193, 29239766, 32118580
Cystic Fibrosis	Inhibit	35315363
Cystitis Interstitial	Stimulate	24146927
Cystitis Interstitial	Associate	36045687
Cysts	Associate	21266527, 21722895, 30012121, 30794864
Cytokine Release Syndrome	Stimulate	22275154, 28696356, 33958662, 38097400
Cytokine Release Syndrome	Associate	33414262
Cytomegalovirus Infections	Stimulate	28501927
Cytomegalovirus Infections	Associate	28501927, 32532356
Deafness Autosomal Recessive 63	Stimulate	30641908
Death	Associate	26245468, 32532356, 37821269
Deficiency of interleukin 1 receptor antagonist	Associate	32819369
Dementia	Associate	18631256, 20336759, 21509504, 21968104, 35950445
Demyelinating Diseases	Associate	27733565
Dengue	Associate	31521850
Dengue	Stimulate	36569864
Dental Caries	Associate	21261944, 25476976, 30803280, 36569197
Dental Caries	Stimulate	37957648
Dental Leakage	Associate	37924741
Dentin dysplasia sclerotic bones	Associate	33385378
Depressive Disorder	Stimulate	18063307, 29856741
Depressive Disorder	Associate	23852407, 24598699, 26891860, 30994834, 32495042, 35964023
Depressive Disorder Major	Associate	17610667, 35964023
Depressive Disorder Major	Stimulate	27138824, 29856741
Depressive Disorder Treatment Resistant	Stimulate	30994834
Dermatitis Atopic	Associate	20631729, 22427475, 30286163, 31049964, 34070943, 36736455
Dermatitis Atopic	Stimulate	32896640, 34678092
Dermatitis Atopic 1	Stimulate	34916261
Dermatitis Contact	Associate	15304089
Dermatitis Exfoliative	Inhibit	36902104
Dermatitis Phototoxic	Associate	26565031
Dermatomyositis	Associate	17265504, 19035492, 24288551, 27803134
Dermatomyositis	Stimulate	27098789
Developmental Dysplasia of the Hip	Associate	25578529
Diabetes Gestational	Stimulate	24055273, 24262292
Diabetes Gestational	Associate	28846666, 33120759, 34235813, 38326276, 39518962
Diabetes Mellitus	Associate	15141093, 16464741, 16864906, 21205020, 21715349, 24782217, 26268591, 27489152, 27749914, 28739185, 28854426, 29484768, 29513874, 34054346, 35851422, 39511203 View all (1 more)
Diabetes Mellitus	Stimulate	25352747, 26604209, 28164132, 31244210, 33958662
Diabetes Mellitus Type 1	Associate	10967112, 16464741, 26692253, 27575603, 28325643, 29941940, 31900242, 32221364, 36929812, 9923604
Diabetes Mellitus Type 1	Stimulate	12410803, 16864906, 17100770, 20153491, 26636339, 29484768
Diabetes Mellitus Type 1	Inhibit	29189980
Diabetes Mellitus Type 2	Stimulate	18664535, 21289232, 25098998, 26095630, 27904654, 29947343, 36351983
Diabetes Mellitus Type 2	Associate	19541594, 23086037, 23110196, 23484124, 27624102, 27749914, 28325643, 29752628, 30139387, 30894604, 32470060, 32561825, 32806763, 35281591, 35954211 View all (4 more)
Diabetic Angiopathies	Stimulate	33323459
Diabetic Ketoacidosis	Associate	17335802
Diabetic Nephropathies	Stimulate	32723296, 38027201
Diabetic Nephropathies	Associate	34219868, 35663044, 38206700
Diabetic Neuropathies	Associate	37197158
Diabetic Retinopathy	Stimulate	25352747, 28726778
Diabetic Retinopathy	Associate	27509144, 33683746, 33958662, 34343639, 38084838, 38222451
Diarrhea 5 With Tufting Enteropathy Congenital	Stimulate	37895018
Diffuse Cerebral Sclerosis of Schilder	Associate	19125864
Disease	Associate	10219772, 22235998, 27803134, 31809599, 31973719, 37175481, 9010269
Disease Progression	Associate	30961940
Down Syndrome	Associate	21712624, 27396555, 33206953
Down Syndrome	Stimulate	30902060
Drug Hypersensitivity	Associate	19657353, 25559824, 27677865, 30620999, 32476816, 33441166, 8325995
Drug Hypersensitivity	Stimulate	24641287
Drug Related Side Effects and Adverse Reactions	Associate	1831797, 23185533, 23209696, 23383347, 25630611, 34092579
Drug Related Side Effects and Adverse Reactions	Stimulate	35459188
Drug Resistant Epilepsy	Stimulate	21315622, 38447234
Dry Eye Syndromes	Associate	22128229, 34048779
Dry Eye Syndromes	Stimulate	27489152, 32476816
Duodenal Ulcer	Associate	10562576, 11531943, 14632761, 17453104, 21445336
Dupuytren Contracture	Associate	8320323
Dysbiosis	Associate	35794610
Dysbiosis	Stimulate	39456258
Dysentery Bacillary	Associate	7622234
Dyskeratosis Congenita	Associate	37717172
Dyskinesias	Associate	26462152
Dyslipidemias	Associate	31480765
Dyspareunia	Associate	32240297
Edema	Associate	34439789
Embolic Stroke	Associate	32223966
Embolism Air	Associate	24945146
Emphysema	Associate	33936110
Empyema	Stimulate	33469074
Encephalitis	Associate	23940760, 28342868
Encephalitis	Stimulate	24330827, 26166618
Encephalocele	Associate	17688691
Endocarditis	Associate	25299518, 28659664
Endocarditis	Stimulate	26225421
Endocrine System Diseases	Associate	37762557
Endometrial Neoplasms	Associate	11285034
Endometriosis	Associate	11665666, 1371258, 17548071, 21640344, 24133591, 27117373, 31408162, 32240297, 36028805, 36233009, 37164275, 39458478
Endometriosis	Stimulate	17678915, 33395071, 36469254, 37095705
Endometriosis	Inhibit	35130311
Endophthalmitis	Stimulate	27293374, 30296277
Endplate Acetylcholinesterase Deficiency	Associate	29529124, 33609694
Enteritis	Stimulate	30908851
Enterocolitis Necrotizing	Stimulate	24732104, 34418984
Enterocolitis Necrotizing	Associate	28658176, 28770467, 34269788
Eosinophilic Esophagitis	Associate	36591238, 37972740
Epidermal Cyst	Associate	33683743
Epidermolysis Bullosa Dystrophica	Stimulate	37161592
Epidermolysis Bullosa Simplex	Associate	34536484
Epilepsies Partial	Associate	39259090
Epilepsy	Associate	25366750, 31948324, 32219137, 32782321, 36089763, 39259090
Epilepsy Post Traumatic	Associate	36089763
Epilepsy Temporal Lobe	Associate	12790892, 14510824, 36929812
Epiphyseal dysplasia multiple 1	Stimulate	29483929
Epstein Barr Virus Infections	Associate	10468855, 36675141
Erysipelas	Associate	28512644
Erythema	Associate	31507596
Erythema elevatum diutinum	Associate	37603510
Erythema Nodosum	Associate	10564558, 20070238
Erythema Nodosum	Stimulate	27474073
Escherichia coli Infections	Stimulate	31694333
Esophageal Neoplasms	Associate	32527212
Esophagitis	Stimulate	32947843, 33941087
Essential Hypertension	Associate	25945941
Essential Tremor	Associate	31092216
Exanthema	Associate	33299659
Extranodal Extension	Associate	32126555
Eye Neoplasms	Associate	10469047
Fabry Disease	Associate	17353161
Fabry Disease	Stimulate	31221509
Failed Back Surgery Syndrome	Associate	35964023
Fallopian Tube Diseases	Associate	12496205
Familial cylindromatosis	Associate	16230348, 36553511
Familial Mediterranean Fever	Associate	16785446, 36624531
Familial Mediterranean Fever	Stimulate	26161132
Fasciitis	Stimulate	36892687
Fatigue	Associate	11121150, 18617366, 23530106, 23852407, 24632226, 27664835, 31846928, 33434563
Fatigue Syndrome Chronic	Associate	36189286, 37373402
Fatty Liver	Inhibit	24716593
Fatty Liver	Associate	27730688, 39179677
Fatty Liver Alcoholic	Inhibit	25512222
Fatty Liver Alcoholic	Associate	27730688, 30794626
Femoracetabular Impingement	Associate	23965695
Femoral Neck Fractures	Associate	17627086
Fetal Growth Retardation	Associate	39618207
Fetal Membranes Premature Rupture	Associate	38115314
Fever	Associate	16988231, 18668591, 2022738, 2212010, 26161132, 28229991, 36551320
Fibrocartilaginous embolism	Associate	26752489, 27385596, 29617687, 30261504, 30468453, 31481088, 31927560, 32016951, 32036721, 32196619, 32271397, 32495856, 32626912, 33111436, 33336720 View all (11 more)
Fibrocartilaginous embolism	Stimulate	32271399, 32572902, 37603510
Fibrosarcoma	Inhibit	24085323
Fibrosis	Associate	16610058, 21526159, 24622053, 26406983, 27730688, 30616602, 34774066, 7752582, 7752583
Fibrosis	Stimulate	32774066
Fibrosis	Inhibit	33831572
Focal Cortical Dysplasia	Associate	29162878
Focal cortical dysplasia of Taylor	Associate	20345941
Folliculitis	Associate	29542810
Fractures Bone	Associate	26798640, 37038178
Frontotemporal Dementia	Associate	21212632
Fuchs' Endothelial Dystrophy	Associate	9234795
Gastritis	Associate	20979650, 22714811, 23995914, 25292060, 26517486
Gastritis Atrophic	Associate	12528938, 15247172, 19861615, 26158864, 27340011
Gastro enteropancreatic neuroendocrine tumor	Associate	32156252
Gastroesophageal Reflux	Associate	16120761, 20385987, 25910374, 25910560
Gastrointestinal Hemorrhage	Associate	39194098
Gastrointestinal Neoplasms	Associate	23174018
Gaucher Disease	Associate	10400826, 26486234
Gaucher Disease	Stimulate	35886988
Geographic Atrophy	Associate	26746578
Gerodermia osteodysplastica	Associate	32735324
Giant Cell Arteritis	Associate	29731755, 8083354
Giant Cell Arteritis	Stimulate	37703805
Gilbert Disease	Associate	28389660
Gingival Diseases	Associate	31743516
Gingival Overgrowth	Associate	22934794
Gingivitis	Associate	28367892, 34193520
Gingivitis	Stimulate	37986309
Glaucoma	Associate	26120586
Glaucoma Open Angle	Associate	20565898, 23800300, 30465622
Glaucoma Open Angle	Stimulate	26120586
Glioblastoma	Associate	10349844, 11078722, 1711536, 18694480, 1974176, 24457964, 25054228, 25409926, 28012022, 29559295, 31282108, 40725140
Glioblastoma	Stimulate	33652086
Glioma	Associate	19029777, 22752645, 25054228, 29414774, 29769161, 30015880, 31300060, 32358484, 34124933, 7680776, 8869149
Gliosis	Associate	24330827, 35040478
Glomerulonephritis	Associate	8455368, 9263995
Glomerulonephritis IGA	Associate	11849463, 17191083, 30029622
Glomerulonephritis Membranous	Stimulate	28801211
Glomerulonephritis Membranous	Associate	9263995
Glomerulosclerosis Focal Segmental	Associate	30709661, 9263995
Glossitis Benign Migratory	Stimulate	11121150
Glucagonoma	Stimulate	37872588
Glucosephosphate Dehydrogenase Deficiency	Associate	22498095
Glucosephosphate Dehydrogenase Deficiency	Inhibit	31707353
Glutamate Monosodium Sensitivity	Stimulate	33239408
Glycosuria Renal	Associate	30616602
Gout	Associate	22762240, 26462562, 30761138, 35505381, 36123941
Gout	Stimulate	28797095
Graft vs Host Disease	Stimulate	23792271, 30142416, 35486633
Graft vs Host Disease	Associate	29142307, 7867645
Gram Positive Bacterial Infections	Associate	26932518, 31416821
Granuloma	Stimulate	16622230
Granuloma	Associate	25476976, 7684503
Granuloma Giant Cell	Associate	22157665
Granulomatous Disease Chronic	Associate	20133696
Granulomatous Disease Chronic	Stimulate	23386602
Granulomatous Mastitis	Associate	39922144
Graves Disease	Associate	11422195, 16025481, 17964974, 19793334, 1993363, 30814438, 33912135, 34790822
Graves Disease	Stimulate	27340508
Graves Ophthalmopathy	Associate	19117935, 33488522, 33542676, 34383782, 35980936, 36521376, 37989267
Graves Ophthalmopathy	Stimulate	23633206
Growth Disorders	Stimulate	29699061
Guillain Barre Syndrome	Associate	33751722, 37041166, 38143756
Haemophilus Infections	Stimulate	11349030, 35570583
HAIR AN syndrome	Stimulate	23110196
Hand Foot and Mouth Disease	Associate	26166120
Hand Foot and Mouth Disease	Stimulate	37725516
Hashimoto Disease	Associate	17115419, 34790822
Hashimoto Disease	Stimulate	29877208, 30814438
Head and Neck Neoplasms	Associate	32736506, 36342298
Hearing Loss	Associate	26392121
Hearing Loss Sensorineural	Associate	28501927
Heart Arrest	Stimulate	27260481
Heart Diseases	Associate	27733811, 35463659, 36255356, 37268894
Heart Failure	Associate	24247107, 28072632, 29683921, 31059043, 31612215, 36303443, 37968611
Heart Failure	Inhibit	35409075
Heart Failure Systolic	Stimulate	36303443
Heart Valve Diseases	Associate	29548280
Helicobacter Infections	Associate	11346459, 12528938, 14632761, 15247172, 16425433, 22714811, 24379597, 25292060, 26158864, 26211930, 26517486, 27340011, 28110439
Helicobacter Infections	Stimulate	15627645, 16425433, 16437693, 22415887, 23451225
Hemangioma Cavernous Central Nervous System	Associate	19164476
Hematoma	Associate	37038178
Hemoglobinuria Paroxysmal	Associate	1378450
Hemolytic Uremic Syndrome	Associate	12135770, 24989888, 8359910
Hemolytic Uremic Syndrome	Stimulate	25174507
Hemophilia A	Associate	21362111
Hemophilia B	Associate	26516624
Hemorrhage	Associate	31217347
Hemorrhoids	Associate	39766795
Hepatic Encephalopathy	Associate	26757951
Hepatitis Autoimmune	Associate	21526159
Hepatitis B	Associate	16521194, 32532356
Hepatitis B	Inhibit	24025329
Hepatitis B Chronic	Associate	16521194, 37208599
Hepatitis C	Associate	23633957, 32532356
Hepatitis C	Stimulate	30679661
Hepatitis C Chronic	Associate	16425360, 32532356
Hepatitis C Chronic	Stimulate	18063307, 22302133, 23633957
Hepatolenticular Degeneration	Stimulate	40214068
Hereditary Angioedema Type III	Stimulate	36553538
Hereditary Autoinflammatory Diseases	Associate	12384940, 18576390, 19877056, 20131254, 23087183, 26992230, 27030597, 27040374, 27994071, 29434599, 31509228, 32716363, 33525735, 36250618, 36596474, 39622350 View all (1 more)
Hereditary Autoinflammatory Diseases	Stimulate	27377765
Hereditary Breast and Ovarian Cancer Syndrome	Associate	36318106
Hereditary leiomyomatosis and renal cell cancer	Associate	8443970
Hidradenitis Suppurativa	Associate	27206704, 30528824, 34724272, 37271319
Hip Injuries	Inhibit	34172608
Hippocampal Sclerosis	Associate	12790892, 29162878
Hirschsprung Disease	Associate	36248794
Histiocytoma Benign Fibrous	Associate	8382509, 9534885
Histiocytosis Langerhans Cell	Associate	34619771
HIV Infections	Associate	1700829, 18344712, 20497296, 24086545, 24585897, 24939850, 25058515, 25535857, 27321752, 27599995, 27875993, 30776150, 31323092, 33841412, 34446704, 36204643, 36298774, 8896413 View all (3 more)
HIV Infections	Stimulate	25536401, 37404829, 9272912
HIV Infections	Inhibit	37376629
Hodgkin Disease	Associate	1700619, 26406983, 38489975
HTLV I Infections	Associate	1920627
HTLV I Infections	Stimulate	24939850
Huntington Disease	Stimulate	25798846
Huntington Disease	Associate	33679692
Hydatidiform Mole	Associate	32484253
Hyperacusis	Associate	21876553
Hyperalgesia	Associate	35040478
Hyperandrogenism	Associate	23116196
Hypercalcemia	Associate	2212010
Hyperglycemia	Stimulate	18599614, 23484124, 27731349
Hyperglycemia	Inhibit	27294162
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	30114628
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	32561825, 37240180
Hyperinsulinism	Stimulate	23484124
Hyperoxia	Associate	10070569, 14617515, 9529979
Hyperoxia	Stimulate	31411059
Hyperplasia	Associate	12528110
Hyperplasia	Stimulate	25312962
Hypersensitivity Delayed	Associate	1458689, 20417488
Hypertension	Associate	19309436, 24782217, 29774543, 33652665, 37675573
Hypertension Pregnancy Induced	Stimulate	39503530
Hypertension Pulmonary	Associate	23153648, 31703702
Hypertensive Retinopathy	Associate	35979044
Hyperuricemia	Associate	35505381, 36123941
hyperzincemia and hypercalprotectinemia	Stimulate	36203570
Hypomagnesemia primary	Associate	26579841
Hypothermia	Associate	17320940
Hypothyroidism	Associate	19793334
Hypothyroidism Congenital Nongoitrous 2	Associate	18710704
Hypoxia	Stimulate	12050157, 15334456, 17456758, 22866899, 25185259, 25510649, 25861162, 26974319, 27058421, 27408996, 29941940, 30415294, 32033172, 32778144, 33136275, 34240756 View all (1 more)
Hypoxia	Associate	1373333, 21263749, 22294296, 24457964, 26696754, 30255592, 30468453, 30704983, 31935962, 36824025, 37735391, 37753073, 7528138, 8901607
Hypoxia	Inhibit	17372675
Hypoxia Brain	Inhibit	17372675
Hypoxia Brain	Associate	17763440, 26696754, 30468453, 32264730, 35005769
Hypoxia Brain	Stimulate	26229239, 32033172, 37753073
Hypoxia Ischemia Brain	Associate	29931509
Ichthyosis	Stimulate	27554821
Idiopathic Noncirrhotic Portal Hypertension	Associate	21455331, 25080058, 26820153
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	34887625
Idiopathic Pulmonary Fibrosis	Associate	11980586, 22059992, 23755232, 30619270, 30988425, 32750409
Idiopathic Pulmonary Fibrosis	Stimulate	26743485, 34220810, 36791050
IgA Deficiency	Associate	9263995
IgA Vasculitis	Associate	11678909, 14558087, 15142264, 1658048, 3264773, 8299714, 8311538, 9014820, 9041934, 9893571
Ige Responsiveness Atopic	Associate	24654313, 36518750
IgG Deficiency	Inhibit	9409648
Immune Reconstitution Inflammatory Syndrome	Stimulate	28316373
Immune System Diseases	Associate	24105615, 3264291
Immunoglobulin G4 Related Disease	Associate	27358392, 35218237
Infant Newborn Diseases	Associate	33768526
Infarction	Associate	31480765
Infarction Anterior Cerebral Artery	Stimulate	39394477
Infections	Stimulate	10497105, 10950106, 11258803, 11853174, 12065506, 12952260, 16232223, 21994456, 23251650, 23326599, 24086645, 24592909, 27391467, 28083517, 31244210 View all (7 more)
Infections	Associate	11918712, 16322091, 21106803, 21957307, 23703470, 23995914, 24094526, 24633341, 25355795, 25398456, 25540075, 25847448, 25893807, 26657940, 26932518 View all (12 more)
Infections	Inhibit	16738534, 22727020, 34994081
Infectious Mononucleosis	Associate	32124188, 8298133
Inferior Wall Myocardial Infarction	Associate	33678651
Inferior Wall Myocardial Infarction	Stimulate	37253636
Infertility	Associate	23375040
Infertility Male	Associate	28974117
Inflammation	Associate	10219766, 10233853, 10339575, 10438545, 10693865, 10693873, 10712238, 10746728, 10823949, 10884313, 10919362, 10933353, 10967112, 11032886, 11076651 View all (1022 more)
Inflammation	Stimulate	10515411, 11290562, 11483667, 11568005, 11851889, 12171950, 12514595, 16984635, 17321344, 18037968, 18390475, 21261944, 21370218, 21458577, 21676422 View all (163 more)
Inflammation	Inhibit	31083232, 33656805, 35454123, 36577761, 38554980
Inflammatory Bowel Diseases	Associate	10337015, 11600466, 20509889, 23800789, 29434599, 31417161, 36647737, 7586694, 9536946, 9665472, 9771403
Inflammatory Bowel Diseases	Inhibit	35022690
Inflammatory Bowel Diseases	Stimulate	35190924, 39487408, 9414973
Influenza Human	Associate	23148654, 23737648, 24696530, 26657940, 31196204, 32651212
Influenza Human	Stimulate	25254368
Insulin Resistance	Stimulate	11342531
Insulin Resistance	Associate	24055273, 24918199, 24969107, 26718495, 29947343, 37047241
Insulinoma	Associate	18263705
Intervertebral Disc Degeneration	Inhibit	16775326
Intervertebral Disc Degeneration	Associate	17760968, 20661932, 20690185, 24551286, 25209447, 25284686, 26877238, 27391542, 30076336, 30261504, 31056946, 31140325, 32705171, 33652921, 33764282 View all (13 more)
Intervertebral Disc Degeneration	Stimulate	26668319, 36578051
Intervertebral disc disease	Associate	21837414, 24551286, 26774625, 27146654, 27512095, 31056946, 35613904
Intervertebral disc disease	Stimulate	23014739
Intervertebral Disc Displacement	Associate	23014739
Intestinal Diseases	Associate	15229109, 15247172, 20473875, 23995914, 29142307
Intestinal Neoplasms	Associate	25745771
Intestinal Polyposis	Associate	38297356
Intra Articular Fractures	Associate	34649564
Intracranial Aneurysm	Associate	37752552
Intracranial Arteriovenous Malformations	Associate	19092239
Intracranial Hemorrhages	Associate	19092239, 29932521
Intracranial Hypertension	Stimulate	21676422
Intussusception	Stimulate	34284276
Invasive Pulmonary Aspergillosis	Associate	24274595, 30363691
Iron Deficiencies	Associate	23451225, 26211930, 37175630
Irritable Bowel Syndrome	Stimulate	12631663
Irritable Bowel Syndrome	Associate	15247174, 23028414, 24667736, 33441166, 37404119
Ischemia	Associate	27864235
Ischemic Stroke	Associate	34970793, 35673992
Ischemic Stroke	Stimulate	39394477
Jaundice	Associate	24884871, 27252406
Jaundice Obstructive	Associate	27252406
Job Syndrome	Stimulate	10400826
Joint Diseases	Associate	11056661, 12634226, 9135824
Juvenile gout	Stimulate	31059009
Kashin Beck Disease	Stimulate	17945513
Keratitis	Associate	25741769, 28573109
Keratoconjunctivitis	Associate	24679443
Keratoconus	Associate	19043479, 23592922
Keratoconus	Stimulate	29021606
Keratoderma Palmoplantar	Associate	30484821
Kernicterus	Stimulate	33263631
Ketosis	Associate	21992747
Kidney Calculi	Associate	35016690
Kidney Diseases	Associate	16436009, 24701032, 28359253, 31509231, 8455368
Kidney Diseases	Stimulate	34118858
Kidney Failure Chronic	Associate	15954918, 37439962
Kidney Neoplasms	Associate	32123166
Kinesiophobia	Associate	24598699
Labor Pain	Stimulate	17823277
Labor Pain	Associate	23666959, 36190386
Labyrinth Diseases	Associate	21199898, 23912888
Labyrinth Diseases	Stimulate	35322136
Laminopathies	Associate	32585971
Laryngopharyngeal Reflux	Associate	38471420
Latent Infection	Associate	29888256
Lead Poisoning Nervous System	Associate	23826419, 25329476, 33094798, 38146363, 40170451
Lead Poisoning Nervous System	Stimulate	35723551
Leiomyoma	Associate	17222831
Leiomyoma	Inhibit	34256950
Leishmaniasis Cutaneous	Associate	32766167
Leishmaniasis Mucocutaneous	Associate	8443970
LEOPARD Syndrome	Associate	17114844
Leprosy	Associate	19618085, 28166214, 32372760
Leprosy	Stimulate	23283470
Leprosy Lepromatous	Associate	34168371
Leukemia	Associate	11264180, 1700730, 1835893, 1932751, 20607236, 22370360, 25847448, 2887587, 33121233, 3316474, 7730146, 7867645, 8286744
Leukemia Hairy Cell	Associate	2258703
Leukemia Large Granular Lymphocytic	Associate	12139733
Leukemia Lymphocytic Chronic B Cell	Associate	2044220, 2258703
Leukemia Lymphoma Adult T Cell	Associate	10753855, 2887587
Leukemia Monocytic Acute	Associate	10765922
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1932751, 26831735, 7780147, 7949186
Leukemia Myeloid	Associate	1932751, 2175219, 3316474
Leukemia Myeloid Acute	Associate	10515888, 12689943, 1373331, 1835893, 23616009, 2522658, 2665849, 28084439, 33121233, 3316474, 34857894, 3498521, 8400299, 8541550, 8805932, 9312169 View all (1 more)
Leukemia Myelomonocytic Chronic	Associate	38118408
Leukemia Myelomonocytic Juvenile	Associate	8286744, 8839857
Leukemia Prolymphocytic T Cell	Associate	11703320, 24219331
Leukemia Promyelocytic Acute	Associate	15304040, 2435815, 28343272, 30237268, 8193361
Leukemia T Cell	Associate	20377589
Leukocytosis	Associate	2212010, 22965887
Leukoencephalopathies	Associate	21889590
Leukoencephalopathies	Stimulate	36280708
Lichen Planus	Associate	26632637
Lichen Planus Oral	Associate	36450755, 39516476, 7738356
Light Fixation Seizure Syndrome	Stimulate	12065506
Liposarcoma	Associate	11278855
Liposarcoma	Inhibit	24085323
Liver Cirrhosis	Associate	39179677
Liver Cirrhosis Alcoholic	Associate	19278365
Liver Cirrhosis Biliary	Associate	11056661, 19604266, 26554784, 29434599, 30600293, 34367180
Liver Cirrhosis Biliary	Inhibit	1772964
Liver Cirrhosis Biliary	Stimulate	38228248
Liver Diseases	Inhibit	1772964
Liver Diseases	Stimulate	29969462, 33469074
Liver Diseases	Associate	30133944, 30776150
Liver Diseases Alcoholic	Associate	38146363
Liver Failure	Associate	30776150, 34551597
Liver Failure Acute	Associate	1772964
Liver Neoplasms	Associate	26301107
Long QT Syndrome	Associate	12790892
Low Back Pain	Associate	27146654
Low Tension Glaucoma	Associate	20565898, 26396484
Lung Diseases	Associate	16858010, 19431193, 23153648, 24853301, 25329476
Lung Diseases	Stimulate	24696530
Lung Diseases	Inhibit	36255321
Lung Injury	Associate	26722511, 27449086, 35794610
Lung Neoplasms	Inhibit	15048152, 29408308
Lung Neoplasms	Associate	18757527, 18801189, 19723873, 20035239, 22923190, 25597281, 25910707, 26968871, 29408308, 31941995, 32924180, 34205482, 36149146, 37147350, 37985999, 38188678, 8144399, 9353425 View all (3 more)
Lung Neoplasms	Stimulate	23762239, 36097589
Lupus Erythematosus Cutaneous	Stimulate	35356994
Lupus Erythematosus Systemic	Associate	14672899, 16436009, 19479852, 20334681, 20434119, 20805419, 25109676, 26182076, 27110576, 27488002, 28153882, 28564495, 29930551, 30466076, 32871918 View all (4 more)
Lupus Erythematosus Systemic	Stimulate	23315075, 25548434, 28286780, 29550813, 32868411, 39818255
Lupus Nephritis	Stimulate	16408116, 31509231, 36610524, 37099456
Lupus Nephritis	Associate	39224582
Lymphadenitis	Associate	1700619
Lymphatic Metastasis	Stimulate	16203990
Lymphatic Metastasis	Associate	16464738, 32851926
Lymphoma	Associate	38489975
Lymphoma B Cell	Associate	23388709, 26448050
Lymphoma Large B Cell Diffuse	Associate	22980495, 39614427
Lymphoma Non Hodgkin	Associate	1700619
Lymphoma T Cell	Associate	32124188
Lymphoproliferative Disorders	Associate	2258703
Macrophage Activation Syndrome	Associate	24098711
Macular Degeneration	Associate	25978536, 27733811, 33510953, 34202702
Macular Edema	Stimulate	24319335
Macular Edema	Associate	29303154, 37924741
Majeed syndrome	Associate	23087183, 33314777
malar rash	Associate	27488002
Malaria	Associate	12472674, 16705810
Malaria	Stimulate	26939933
Malaria Cerebral	Associate	16705810, 20011600
Malformations of Cortical Development Group I	Stimulate	35484121
Marfan Syndrome	Stimulate	37445606
Mast Cell Activation Disorders	Associate	33882986
Measles	Stimulate	17538120
Melanoma	Associate	16100443, 16675961, 17141217, 20181932, 22850568, 25484078, 30149677, 31099111, 31591149, 32098891, 35669782, 36707938
Melanoma	Stimulate	2017372, 21954434
Melanoma Cutaneous Malignant	Associate	36707938, 38052629
Meniere Disease	Associate	35322136, 39622350
Meningitis Bacterial	Associate	16705810, 2022738, 21473761, 36119025, 9242541
Meningitis Viral	Associate	27914455
Meningococcal Infections	Associate	8277177
Mental Disorders	Associate	31786499
Mesothelioma Malignant	Associate	25757056, 2787682, 32530527, 33085641
Metabolic Diseases	Associate	23484124, 28592801, 31383786, 31735077
Metabolic Syndrome	Associate	17634253, 29067980
Metabolic Syndrome	Stimulate	21289232, 22357188, 26516848
Mevalonate Kinase Deficiency	Stimulate	12384940, 27377765
Mevalonate Kinase Deficiency	Associate	18684863, 25107911, 33525735
Microcephaly	Associate	30199767
Microphthalmia Syndromic 10	Associate	28655310
Migraine Disorders	Associate	31214186, 39187749
Mitochondrial Diseases	Associate	29339024, 36891303, 37635488
Mitochondrial Diseases	Stimulate	31106593, 32554850, 33804447, 34216617, 36361846, 36890588, 36982291
Mitral Valve Insufficiency	Associate	33831572
Mitral Valve Stenosis	Associate	33831572
Mixed Dementias	Associate	39880323
Monoclonal Gammopathy of Undetermined Significance	Associate	9864174
Mood Disorders	Associate	26891860, 32377159
Mood Disorders	Inhibit	30504920
Mouth Diseases	Associate	20473875, 23315075, 29018115, 30363691, 35269619
Mouth Neoplasms	Associate	18225559, 26462152
Moyamoya Disease	Inhibit	10559138
Mucocutaneous Lymph Node Syndrome	Stimulate	10233729
Mucocutaneous Lymph Node Syndrome	Associate	20081319, 21048327, 23298273, 28069066, 31093510, 34174887, 35699824, 36536067, 38273388
Mucus Inspissation of Respiratory Tract	Associate	29946002
Multiple Myeloma	Associate	10050719, 10848780, 22540426, 22567049, 2297574, 25469832, 26146985, 2783861, 30211233, 33963182, 39268982, 9864174, 9886334
Multiple Myeloma	Stimulate	15287939
Multiple Sclerosis	Associate	12775358, 18322311, 20661655, 24098530, 28623311, 30409508, 33203651, 33766068, 35648256
Multiple Sclerosis	Stimulate	25704169, 35158367
Multiple Sclerosis	Inhibit	33318307
Multiple Sclerosis Chronic Progressive	Stimulate	24098530
Multiple Sclerosis Relapsing Remitting	Stimulate	22978757
Multiple Sclerosis Relapsing Remitting	Associate	25586466
Mumps	Associate	18715339
Muscle Neoplasms	Associate	28114971
Muscular Dystrophy Duchenne	Associate	28129679, 29194448, 30451963
Musculoskeletal Diseases	Associate	23417678
Myalgia	Associate	35981730
Mycobacterium avium intracellulare Infection	Associate	31467293, 9657559
Mycobacterium avium intracellulare Infection	Stimulate	36678131
Mycobacterium Infections Nontuberculous	Associate	31467293, 36255321
Mycoses	Stimulate	22988082
Mycoses	Associate	25741769, 29673332
Myelodysplastic Syndromes	Associate	11122147, 37420006, 8839858
Myelodysplastic Syndromes	Inhibit	34335093
Myocardial Infarction	Stimulate	10475771, 31257469
Myocardial Infarction	Associate	11527622, 22768033, 26505348, 27864235, 27967213, 33847684, 34799616, 35005769, 35231061, 35432334, 39809140
Myocardial Reperfusion Injury	Associate	31799681
Myocardial Stunning	Associate	24247107
Myocarditis	Stimulate	38521068
Myoma	Associate	23690221
Myopathies Structural Congenital	Associate	38037545
Myositis	Associate	10886238, 15731288, 22577940
Myositis Inclusion Body	Associate	18420712
Myotonic Dystrophy	Associate	25080058, 28164132
Myotonic Dystrophy	Stimulate	33172487, 33287713, 38271857
Nasal Polyps	Stimulate	33785041, 39191825
Nasopharyngeal Carcinoma	Associate	10929762, 28732079, 37925811
Nasopharyngeal Carcinoma	Stimulate	28207826
Nasopharyngeal Neoplasms	Associate	10929762
Neck Pain	Stimulate	38097400
Necrosis	Stimulate	24982891
Necrosis	Associate	26245468, 38115314, 8298133
Neointima	Associate	11703589
Neoplasm Metastasis	Associate	19390242, 21486440, 26176534, 28427195, 31356195, 34076990, 34272498, 36036818, 36499741, 37872588, 39766795
Neoplasm Metastasis	Stimulate	40725140
Neoplasms	Inhibit	10369458, 10601837, 29554943, 30180849, 31901915, 36037155
Neoplasms	Associate	10496353, 11076651, 12853386, 15188028, 16094523, 16436009, 17088911, 17394066, 17453104, 17703300, 18205904, 18225559, 18542048, 18617366, 18769122 View all (107 more)
Neoplasms	Stimulate	1555590, 17261184, 18294286, 19055699, 19138976, 20607236, 22429778, 23762239, 26759080, 29188362, 29940792, 30641908, 32323780, 32530527, 33658555 View all (6 more)
Neoplasms Adipose Tissue	Associate	35894174
Neoplasms Basal Cell	Associate	8100398
Neoplasms Glandular and Epithelial	Associate	26753875
Neoplastic Cells Circulating	Associate	15920147
Nephrosis Lipoid	Associate	9263995
Nephrotic Syndrome	Associate	35837376
Nerve Degeneration	Associate	15201366, 17881264, 24551286, 25978536, 26577823, 28655310, 35325812, 36677744
Nerve Degeneration	Stimulate	30261504, 32572904, 33015765
Nervous System Diseases	Associate	11032886
Neuralgia	Associate	27145808, 35867896
Neuroblastoma	Associate	11282550, 33246119, 9459616
Neurodegenerative Diseases	Stimulate	16705810
Neurodegenerative Diseases	Associate	21308746, 25197660, 31119842, 32377159
Neuroectodermal Tumors Primitive	Associate	21988351
Neuroendocrine Tumors	Associate	21988351, 31084373
Neuroinflammatory Diseases	Associate	17989372, 19801956, 21212632, 26939933, 30409508, 32688141, 33113430, 36326669, 36810605, 36903325, 40725140
Neuroinflammatory Diseases	Stimulate	26166618, 32272581
Neurologic Manifestations	Associate	24989888, 26161132, 26166618, 27270586
Neurologic Manifestations	Stimulate	34450402, 36503883
Neuromyelitis Optica	Stimulate	28946890
Neurotoxicity Syndromes	Stimulate	11927634, 28655310
Neurotoxicity Syndromes	Associate	27270586, 33414262
Neutropenia	Associate	9325020
Neutrophil Immunodeficiency Syndrome	Associate	17003486, 25616863, 28490868
Neutrophil Immunodeficiency Syndrome	Stimulate	34344357
Neutrophilia Hereditary	Stimulate	24750386, 27155035
Niemann Pick Disease Type C	Associate	33038032
Niemann Pick Diseases	Associate	7980390
No Reflow Phenomenon	Associate	28770467
No Reflow Phenomenon	Stimulate	32245321
Non alcoholic Fatty Liver Disease	Associate	24716593, 27730688, 36380355
Non Muscle Invasive Bladder Neoplasms	Associate	20096140, 21308147, 24631944
Non ST Elevated Myocardial Infarction	Stimulate	34387532
Obesity	Associate	16968396, 18239554, 18573495, 19398847, 19666082, 23484124, 24006511, 24141239, 24782217, 24918199, 26516848, 27907186, 28105927, 28515391, 28592801 View all (14 more)
Obesity	Stimulate	23110196, 24262292, 29548899, 30287405, 31787760, 32469992, 33504180, 35301059
Obesity Abdominal	Associate	31272370
Obesity Metabolically Benign	Associate	27907186
Obesity Morbid	Associate	32545403
Obstetric Labor Premature	Associate	20965572, 28122480
Oculocerebrorenal Syndrome	Associate	11600466
Oculocerebrorenal Syndrome	Stimulate	16868967, 36646016
Oligospermia	Associate	17335817, 28974117
Opioid Related Disorders	Associate	31687981
Optic Neuropathy Ischemic	Stimulate	21418620
Oral Submucous Fibrosis	Associate	39516476
Oral Ulcer	Associate	26125891
Oropharyngeal Neoplasms	Associate	30191960
Osteitis	Associate	23087183
Osteoarthritis	Associate	10806046, 11083263, 11083278, 11352237, 11714393, 12507586, 12801479, 12937131, 14962956, 15077300, 15176972, 15880595, 16311048, 16492401, 16679036 View all (141 more)
Osteoarthritis	Stimulate	15731292, 21352802, 21717421, 25432384, 30186872, 31017304, 31383786, 31915516, 32037864, 32072994, 32380078, 33675175, 34448795, 35328777, 35955467, 36253872, 37507717 View all (2 more)
Osteoarthritis Hip	Associate	15077300, 17532232, 21671260, 33407301
Osteoarthritis Knee	Associate	21717421, 23216199, 32059658, 34073132, 34992344, 37573584, 39809203
Osteoarthritis Knee	Stimulate	32912331, 40211184
Osteogenesis imperfecta type 1A	Associate	37410216
Osteolysis	Associate	20935210
Osteomyelitis	Associate	28682145, 30949508, 32454789, 38401466
Osteoporosis	Associate	11600466, 15176972, 20940514, 29521042, 29745905, 35791093, 36553538, 39596387
Osteoporosis	Stimulate	37038178
Osteoporotic Fractures	Associate	29521042
Osteosarcoma	Associate	10691855, 24878968, 35326493, 40616392
Osteosarcoma	Stimulate	9057843
Otitis Media	Associate	24718616, 26496338
Ovarian Cysts	Associate	21722895
Ovarian Diseases	Associate	37883761
Ovarian Neoplasms	Associate	25376541, 26357657, 31902257, 31924656, 33921111, 35935940, 37644468, 9262967
Overweight	Associate	19666082, 37675573
Overweight	Stimulate	28569167
Pain	Associate	21717421, 23864770, 28413930, 31056946, 31846928, 35964023, 36301901
Pain	Stimulate	22875918, 34602367
Palindromic rheumatism	Stimulate	31421660
Pancreatic Intraductal Neoplasms	Associate	21266527
Pancreatic Neoplasms	Associate	11076651, 16094523, 18571585, 19671674, 29224225, 30794864, 31609478, 37914939, 39260693
Pancreatitis	Associate	25730036, 28935577, 39372399, 9334358
Pancreatitis	Stimulate	34599510
Pancreatitis Alcoholic	Associate	24835349
Papilloma Choroid Plexus	Associate	9003063
Papillomavirus Infections	Associate	35017496, 36342298
Paraneoplastic Syndromes	Associate	2212010
Paraparesis Tropical Spastic	Associate	22335964
Parkinson Disease	Stimulate	10212304, 25329911, 27735031, 30813952, 31915018, 36301901, 36768317, 38485911, 40133863
Parkinson Disease	Associate	20427258, 28943632, 30813952, 31455413, 31828965, 33577043, 37773866
Paroxysmal Extreme Pain Disorder	Associate	30949508
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	36117020
Pelvic Pain	Associate	37164275
Pemphigoid Bullous	Associate	30484821, 31001258, 31507596, 35140724
Pemphigus	Associate	31211854
Penile Neoplasms	Stimulate	37763742
Peptic Ulcer	Associate	11531943, 12528938, 19030199, 26601827
Peri Implantitis	Associate	12372467, 26424287, 34931168, 35855430
Peri Implantitis	Stimulate	34273529, 36834667
Periapical Diseases	Associate	25476976, 30012121
Periapical Granuloma	Stimulate	30012121
Periapical Granuloma	Associate	34182485, 39401546
Periapical Periodontitis	Associate	21419289, 35300329
Pericarditis	Associate	35658515
Periodic fever familial autosomal dominant	Stimulate	31009059, 33674380, 37500699
Periodic fever familial autosomal dominant	Associate	33340091, 39809140
Periodontal Diseases	Associate	17100776, 18541658, 19118102, 19405838, 24460370, 35665507, 36429405, 39337647, 9605989
Periodontal Diseases	Inhibit	37175429
Periodontitis	Stimulate	16542362, 20059421, 22926406, 35665507
Periodontitis	Associate	18723088, 19405838, 23046796, 24690098, 24843315, 25483140, 25861162, 28341818, 29023524, 30944162, 31978095, 32618013, 33638191, 35810010, 35844512 View all (7 more)
Peripheral Arterial Occlusive Disease 1	Associate	32481342
Periprosthetic Fractures	Associate	29305046
Peritoneal Neoplasms	Stimulate	25228544
Peritonitis	Associate	23392590, 23760290, 37149550
Peritonitis	Stimulate	38114999
Personality Disorders	Associate	28105927, 32495042
Pharyngeal Neoplasms	Associate	23867201
Plaque Atherosclerotic	Associate	27207962, 35008765, 9691094
Plaque Atherosclerotic	Stimulate	34269613
Pleural Effusion	Associate	1371640, 33469074
Pleural Effusion	Stimulate	35819097
Pleural Effusion Malignant	Associate	35137541
Pneumococcal Infections	Associate	23865742
Pneumonia	Associate	20035239, 36923408
Pneumonia	Stimulate	31310589, 37725516
Pneumonia Mycoplasma	Stimulate	29849498
Pneumonia Ventilator Associated	Stimulate	25289689
Polyarteritis Nodosa	Associate	17393409
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	19125864
Polycystic Ovary Syndrome	Associate	19909950, 23375040, 32785222, 35551681
Polycystic Ovary Syndrome	Stimulate	31902257
Polycythemia Vera	Associate	22965887
Polymyalgia Rheumatica	Associate	8083354
Polymyositis	Associate	17265504
Polymyositis	Stimulate	27098789
Polypoidal Choroidal Vasculopathy	Associate	25978536
Polyps	Stimulate	34060497
Positive Pressure Respiration Intrinsic	Associate	31507596
Post Acute COVID 19 Syndrome	Associate	36189286, 36379915
Post Infectious Disorders	Associate	12631663
Prader Willi Syndrome	Stimulate	32495042
Prader Willi Syndrome	Associate	37251380
Pre Eclampsia	Associate	16436659, 18276934, 18467705, 20668109, 21352397, 22947907, 25879409, 26970370, 27999242, 28558299, 30606080, 38002326, 39202588
Pre Eclampsia	Stimulate	26053021, 30133944, 33117348
Precancerous Conditions	Associate	11936957
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25418470, 26932518, 36124714, 39984900
Preeclamptic toxemia	Stimulate	26053021, 31138166
Pregnancy Complications	Associate	28515391
Premature Birth	Stimulate	17940116, 30596707
Premature Birth	Associate	18951205
Pressure Ulcer	Stimulate	21676422
Pressure Ulcer	Associate	37746975
Preterm Premature Rupture of the Membranes	Associate	19272692, 20709392
Primary Graft Dysfunction	Stimulate	18573422
Primary Graft Dysfunction	Associate	23710539, 27773452
Primary Myelofibrosis	Associate	22081434, 27304059, 32923146
Primary Myelofibrosis	Stimulate	39391311
Prolidase Deficiency	Associate	38088248
Prostate Cancer Hereditary 7	Associate	19474090
Prostatic Neoplasms	Associate	18446056, 19474090, 22859398, 23342084, 25103771, 28663562, 31600936, 33050597, 34070682, 34350063
Prostatic Neoplasms	Stimulate	31348843
Prostatic Neoplasms	Inhibit	9792142
Prostatitis	Associate	11774033, 15042672, 18344492
Protein Energy Malnutrition	Associate	38017491
Proteinuria	Associate	26160272
Pruritic urticarial papules plaques of pregnancy	Associate	31507596
Pruritus	Stimulate	38489975
Psoriasis	Associate	11851889, 16567387, 29434599, 30301277, 30998987, 31509228, 33300400, 34279540, 38115636
Psoriasis	Stimulate	25330301
Psychotic Disorders	Associate	29803226
Pterygium	Associate	29724886
Pulmonary Alveolar Proteinosis	Associate	28233860
Pulmonary Arterial Hypertension	Stimulate	20808962
Pulmonary Arterial Hypertension	Associate	34238983
Pulmonary Disease Chronic Obstructive	Associate	12952260, 15994259, 16280439, 17626109, 18579366, 19279357, 21421749, 24975928, 26722511, 30034228, 31601004, 32669843, 32698440, 32842623, 34511895 View all (5 more)
Pulmonary Disease Chronic Obstructive	Stimulate	26317628, 27524865, 27883019, 28490868, 31534438, 35534521, 36097589
Pulmonary edema of mountaineers	Associate	34483727
Pulmonary Embolism	Stimulate	33969714
Pulmonary Fibrosis	Associate	33832291, 34220810
Pulpitis	Associate	35334501
Purpura Thrombocytopenic Idiopathic	Associate	15009068, 20626741, 26076780, 3264291
Purpura Thrombocytopenic Idiopathic	Stimulate	27554456
Pyoderma Gangrenosum	Stimulate	24903614, 25501066
Pyogenic arthritis pyoderma gangrenosum and acne	Associate	14595024
Pyogenic arthritis pyoderma gangrenosum and acne	Stimulate	30131320
Q Fever	Associate	31001808
Q Fever	Stimulate	8613372
Radiation Injuries	Associate	26559268
Radiation Pneumonitis	Associate	34964782
Rectal Fistula	Associate	27402195
Rectal Neoplasms	Associate	24446182, 30563955
Renal Insufficiency	Associate	21419289, 37628639
Renal Insufficiency Chronic	Inhibit	16738534
Renal Insufficiency Chronic	Associate	29543732, 32046176, 33353159, 36591354, 38017491
Renal Insufficiency Chronic	Stimulate	40184113
Reperfusion Injury	Stimulate	29542225
Reperfusion Injury	Associate	31799681, 34868528, 36856879
Respiration Disorders	Stimulate	33958427
Respiratory Distress Syndrome	Associate	11687457, 18065658, 28413930, 32321279, 32720541, 33253913, 34723226, 37296478
Respiratory Distress Syndrome	Stimulate	34163488
Respiratory Sounds	Associate	36451824
Respiratory System Abnormalities	Associate	34664888
Respiratory Tract Diseases	Associate	30961940, 38179046
Respiratory Tract Infections	Inhibit	24718616
Respiratory Tract Infections	Associate	32492562
Restless Legs Syndrome	Associate	23460603
Retinal Diseases	Associate	25978536
Retinal Diseases	Stimulate	37924741
Retinal Dysplasia	Associate	21266527, 23995914, 32703913
Retinal Perforations	Stimulate	19255163
Retinal Vein Occlusion	Associate	31814701, 36180575
Retinitis	Associate	23592910, 34343639
Rheumatic Heart Disease	Associate	29548280
Rheumatoid Nodule	Associate	12571841
Rhinitis Allergic	Associate	24654309, 31185305, 37713866
Rhinitis Allergic Seasonal	Associate	29581620
Ring Chromosome 20 Syndrome	Stimulate	37506161, 38102696
Roberts Syndrome	Associate	33319833
Root Resorption	Associate	25865535, 28863915, 37526277, 38403101
Rotator Cuff Injuries	Associate	11565192, 21484857
Rotator Cuff Injuries	Stimulate	33407301
Rubella	Associate	18715339
Rupture	Inhibit	20537568
Sarcoidosis	Associate	11127488, 18654018, 27402699, 30946009
Sarcoma Kaposi	Associate	21575908, 21792887, 23388709, 8669484
Sarcoma Kaposi	Stimulate	38564482
Sarcoma Synovial	Inhibit	24085323
Sarcoma Synovial	Associate	28782180
Schizophrenia	Associate	22832610, 32109548, 37946206
Schizophrenia	Stimulate	26194183, 27957319, 29803226, 35719348, 37075652
Schizophrenia	Inhibit	29032575
Schnitzler Syndrome	Associate	19825519, 27040374, 29284595, 37551725
Sciatic Neuropathy	Associate	35356751
Scleroderma Systemic	Associate	11710721, 15642145, 8082299
Scleroderma Systemic	Stimulate	14729510
Sclerosis	Associate	9263995
Seizures	Associate	27122151, 32219137, 32782321, 36089763
Seizures Febrile	Associate	12790892, 24668705, 26813462, 28296777, 36089763
Seizures Febrile	Stimulate	34449141, 38218765
Sepsis	Stimulate	14500502, 32496420
Sepsis	Associate	16436009, 23825193, 25619315, 31416821, 33253913, 34566996, 36923408
Sertoli Cell Only Syndrome	Associate	37296437
Severe Acute Respiratory Syndrome	Inhibit	19158276
Severe Acute Respiratory Syndrome	Associate	26893103, 31257148, 33755043
Severe Acute Respiratory Syndrome	Stimulate	37261339
Severe combined immunodeficiency due to adenosine deaminase deficiency	Stimulate	7511077
Severe Dengue	Stimulate	31521850
Sezary Syndrome	Associate	36902104
Shock	Stimulate	9242541
Shock Septic	Stimulate	3491091
Shock Septic	Associate	7867645, 9242541
Shoulder Pain	Associate	24598699, 37864374
Silicosis	Associate	26496436
Sinusitis	Associate	36094193
Sjogren's Syndrome	Associate	31562704, 35705251, 38016737
Sjogren's Syndrome	Stimulate	33603736
Skin Diseases	Associate	19479852, 25330301, 39465738
Skin Diseases	Stimulate	36672844
Sleep Apnea Obstructive	Associate	24293770, 26276663, 28742193, 33378050
Sleep Deprivation	Associate	36982291
Sleep Initiation and Maintenance Disorders	Associate	25535857
Sleep Wake Disorders	Associate	25535857, 26937653
Small Cell Lung Carcinoma	Associate	16721367
Smoke Inhalation Injury	Inhibit	22805115
Soft Tissue Injuries	Associate	24223987, 34059097, 8555483
Spherocytosis Type 1	Associate	14510824
Spinal Cord Injuries	Associate	32537668, 33595805, 33956875, 35412793
Spinocerebellar Ataxia 17	Associate	21637346
Spondylarthritis	Associate	18311795, 18975340
Spondylarthritis	Inhibit	19333931
Spondylarthropathies	Associate	10733472
Spondylitis	Associate	37371064
Spondylitis Ankylosing	Associate	16508980, 16918024, 28423679
Squamous Cell Carcinoma of Head and Neck	Associate	26176534, 26462152, 28861772, 29207019, 31356195, 33232279, 35211756, 36450755, 37686462, 39516476
Squamous Cell Carcinoma of Head and Neck	Inhibit	37505766
Squamous Intraepithelial Lesions	Associate	34106897
ST Elevation Myocardial Infarction	Associate	27864235
ST Elevation Myocardial Infarction	Stimulate	34387532
Staphylococcal Infections	Associate	26225421
Status Asthmaticus	Associate	18390475, 19054597, 19473523, 20705942, 26511361, 32338995, 34344357, 9176529, 9179403
Status Asthmaticus	Stimulate	20816188, 24349168
Status Epilepticus	Stimulate	36802956
Still's Disease Adult Onset	Associate	23497717, 26589963, 27537874, 32377540, 33892792, 37500699, 38124139
Still's Disease Adult Onset	Stimulate	30616678
Stomach Diseases	Associate	12528938, 22714811
Stomach Neoplasms	Associate	10746728, 11936957, 12688521, 14633943, 15851404, 16425433, 16769709, 16804964, 17297261, 17359523, 19132772, 19861615, 21523770, 22414649, 22415887 View all (18 more)
Stomach Neoplasms	Stimulate	15492468, 34773930
Stomach Neoplasms	Inhibit	17453104, 26158864, 33942631
Stomach Ulcer	Associate	20979650
Stomatitis	Associate	35170684
Stomatitis Aphthous	Associate	21478439
Stress Disorders Post Traumatic	Associate	24754437
Stress Disorders Post Traumatic	Stimulate	30777365
Stroke	Inhibit	17981284, 24167359
Stroke	Associate	24190014, 31480765, 35008765, 35673992
Stroke	Stimulate	34201498, 39394477
Subarachnoid Hemorrhage	Stimulate	39195261
succinic semialdehyde dehydrogenase deficiency	Associate	33557678
Superinfection	Associate	30755509
Supranuclear Palsy Progressive	Associate	21741294
Sutton disease 2	Associate	26039006
Sutton disease 2	Stimulate	34972503
Sweet Syndrome	Stimulate	24903614
Sweet Syndrome	Associate	27030597, 36355435
Syndrome	Associate	18344712
Synovial Cyst	Associate	21031267, 32159845
Synovial Cyst	Stimulate	8940164
Synovitis	Inhibit	19333931
Synovitis	Associate	39390512, 9358757
Synovitis Pigmented Villonodular	Associate	32929367
Syphilis	Associate	32532356
Systemic Inflammatory Response Syndrome	Stimulate	20634913, 35700822
Systemic Inflammatory Response Syndrome	Associate	33510953, 37635488
Temporomandibular Joint Disorders	Associate	33145347
Temporomandibular Joint Dysfunction Syndrome	Associate	32468015, 33637064
Tendinopathy	Associate	26156631, 29385715
Tension Type Headache	Stimulate	23957020
Testicular Diseases	Associate	37033952
Thoracic Injuries	Stimulate	26303896
Thrombocytosis	Associate	26490522
Thrombophilia	Associate	15304040
Thrombosis	Associate	19092239, 36226612
Thyroid Cancer Papillary	Stimulate	16203990
Thyroiditis	Associate	10464273, 29877208
Thyroiditis Autoimmune	Associate	17964974, 19793334, 22878044, 25127106, 36387897
Tonsillitis	Associate	28542534
Tooth Diseases	Associate	32952230
Tooth Erosion	Associate	16120761, 22039170, 28458315
Tooth Resorption	Stimulate	29521042
Toxoplasmosis	Associate	34597501
Toxoplasmosis Ocular	Associate	29426041
Trachoma	Stimulate	15557667
Trachoma	Associate	20937763
Transposition of Great Vessels	Associate	35590253
Trichiasis	Associate	27249027
Trigeminal Neuralgia	Stimulate	34067581
Triple Negative Breast Neoplasms	Associate	31105691, 32235890, 32778144, 34072893, 35377948, 36922898, 38254674
Triple Negative Breast Neoplasms	Stimulate	33846813, 35268073
Tuberculosis	Associate	10377182, 15117956, 23486418, 25329476, 29189980, 30481307, 31678658, 33287713, 33841412, 33868225, 35305574, 36204643, 38179046
Tuberculosis Extrapulmonary	Associate	20196868
Tuberculosis Meningeal	Associate	25329476
Tuberculosis Meningeal	Stimulate	26567164
Tuberculosis Meningeal	Inhibit	29778672, 37376629
Tuberculosis Multidrug Resistant	Associate	27681197, 34424286
Tuberculosis Pleural	Associate	10377182
Tuberculosis Pulmonary	Associate	20007364, 26567164, 29888256
Tuberculosis Pulmonary	Stimulate	31226436, 33868225
Tuberous Sclerosis	Associate	27122151
Tympanic Membrane Perforation	Associate	21440944
Ulcer	Associate	26125127
Ureaplasma Infections	Stimulate	18596706
Ureaplasma Infections	Associate	29234642
Urinary Bladder Neoplasms	Associate	32098891
Urinary Incontinence Stress	Associate	35666377
Uterine Cervical Dysplasia	Associate	25893807
Uterine Cervical Neoplasms	Associate	17297261, 19904560, 25893807, 25925136, 26579841, 28402258, 31222982, 31554368, 31943744, 35791307, 36969161, 39289490
Uterine Cervical Neoplasms	Stimulate	19904560
Uterine Cervicitis	Stimulate	19046168
Uterine Cervicitis	Associate	8098584
Uterine Diseases	Associate	18710704
Uveal melanoma	Associate	22429778, 36707938
Uveitis	Associate	37924741
Vaginitis	Stimulate	23375395
Vaginitis	Associate	26951262
Vaginosis Bacterial	Associate	18485781
Vaginosis Bacterial	Stimulate	23375395, 35017496
Varicose Ulcer	Associate	36250733
Vascular Calcification	Associate	32126555
Vascular Diseases	Associate	10872808, 15102770, 24063019, 24612355, 34343639, 9104815
Vascular System Injuries	Associate	26502906
Vasculitis	Associate	3491091, 3526909
Vasospasm Intracranial	Stimulate	25269057
Venous Thromboembolism	Associate	20031567, 37753073
Venous Thrombosis	Associate	38215128
Ventricular Remodeling	Associate	22059992
VEXAS syndrome	Stimulate	38291039
Viremia	Associate	29768624
Virus Diseases	Associate	23927441, 34233673
Virus Diseases	Stimulate	29709093
Visceral myopathy familial external ophthalmoplegia	Associate	23451225
Vision Disorders	Associate	34424286
Vitiligo	Associate	23382179, 25221996, 32705792
Vitreoretinopathy Proliferative	Associate	37107562
Vulvovaginitis	Associate	26951262
Weight Loss	Inhibit	21147860, 21394384
Weight Loss	Associate	26609056
Wolffian tumor	Associate	30336198
Wolfram Syndrome	Associate	33693650
Wounds and Injuries	Associate	24034344, 28316377, 35260041, 35322736, 36949500, 37393232, 8639772
Wounds and Injuries	Stimulate	28356485, 32948212, 34116684, 34796909, 34964696, 35993243, 37820587, 40170451
Xeroderma Pigmentosum	Associate	11710926
Yellow Fever	Associate	11531955
Zika Virus Infection	Stimulate	28153732
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	12812920

IL1B (interleukin 1 beta)