IL18 (interleukin 18)

Gene Gene information from NCBI Gene database.
Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID 3606
Gene name Interleukin 18
Gene symbol IL18
Synonyms (NCBI Gene)
IGIFIL-18IL-1gIL1F4
Chromosome 11
Chromosome location 11q23.1
Summary The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to
miRNA miRNA information provided by mirtarbase database.
41
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (41)
miRTarBase ID miRNA Experiments Reference
MIRT004304 hsa-miR-346 qRT-PCRLuciferase reporter assayWestern blotNorthern blot 19342689
MIRT054556 hsa-miR-197-3p MicroarrayqRT-PCR 23710316
MIRT438748 hsa-miR-130a-3p ELISALuciferase reporter assayqRT-PCR 24801815
MIRT438748 hsa-miR-130a-3p ELISALuciferase reporter assayqRT-PCR 24801815
MIRT1064132 hsa-miR-129-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (6)
Transcription factor Regulation Reference
HDAC9 Unknown 11944905
NFKB1 Activation 15963597;17399992
NFKB1 Unknown 10227974
RELA Activation 15963597;17399992
RELA Unknown 10227974
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
76
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (76)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IDA 11466388
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IDA 14528293, 25500532
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Transcription factors Other IDs Associated diseases
MIM HGNC e!Ensembl
600953 5986 ENSG00000150782
Protein Protein information from UniProt database.
Gene SNPs Transcription factors Other IDs Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14116
Protein name Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
Protein function Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses (PubMed:10653850). Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex whi
PDB 1J0S , 2VXT , 3F62 , 3WO2 , 3WO3 , 3WO4 , 4EEE , 4EKX , 4HJJ , 4R6U , 4XFS , 4XFT , 4XFU , 7AL7 , 8J6K , 8SPB , 8SV1 , 8URV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00340 IL1 72 → 185 Interleukin-1 / 18 Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Expressed in ovarian carcinoma but undetectable in normal ovarian epithelial cells. Resistant to proteolytic activation by caspase-1 and -4. {ECO:0000269|PubMed:15326478}.
Sequence 
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
Sequence length 193
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Three Vessel Coronary Disease Benign rs5744280, rs549908, rs360722 RCV001003438
RCV001003437
RCV001003439
Uterine corpus endometrial carcinoma Benign rs5744251 RCV005908335
Show/Hide Text Mining Associations (471)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 15257727
Abortion Habitual Associate 21840518, 25690033
Abortion Habitual Stimulate 26474737
Abortion Spontaneous Stimulate 39408839
Acquired Immunodeficiency Syndrome Associate 12438570, 19339355, 31401307
Acquired Immunodeficiency Syndrome Stimulate 26475133
Acute Coronary Syndrome Associate 26304941, 31238711
Acute Disease Associate 31427887
Acute Kidney Injury Associate 20558561, 20827258, 22418979, 24820190, 33684160, 39692606
Acute Kidney Injury Stimulate 23317940