Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3593
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 12B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL12B
Synonyms (NCBI Gene) Gene synonyms aliases
CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encode
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT715156 hsa-miR-3614-3p HITS-CLIP 19536157
MIRT715155 hsa-miR-4705 HITS-CLIP 19536157
MIRT715154 hsa-miR-103b HITS-CLIP 19536157
MIRT715153 hsa-miR-6511a-3p HITS-CLIP 19536157
MIRT715152 hsa-miR-6511b-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
EP300 Activation 15482860
ETS2 Unknown 10657616
IRF1 Unknown 10657616
JUN Activation 14688340
KLF1 Unknown 14976188
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001817 Process Regulation of cytokine production TAS 1673147
GO:0001912 Process Positive regulation of leukocyte mediated cytotoxicity IEA
GO:0001916 Process Positive regulation of T cell mediated cytotoxicity IEA
GO:0001916 Process Positive regulation of T cell mediated cytotoxicity ISS
GO:0002230 Process Positive regulation of defense response to virus by host IDA 12421946
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
161561 5970 ENSG00000113302
Protein
UniProt ID P29460
Protein name Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)
Protein function Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. ; Assoc
PDB 1F42 , 1F45 , 3D85 , 3D87 , 3DUH , 3HMX , 3QWR , 4GRW , 5MJ3 , 5MJ4 , 5MXA , 5MZV , 5NJD , 6UIB , 6WDQ , 8CR8 , 8OE4 , 8XRP , 8YI7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10420 IL12p40_C 126 216 Cytokine interleukin-12p40 C-terminus Domain
Sequence
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVH
KLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
Sequence length 328
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Crohn Disease Crohn's disease or Leprosy (opposite effect), Crohn's disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 31277552
Achondroplasia and Swiss type agammaglobulinemia Associate 12823285
Acne Vulgaris Stimulate 38009017
Acquired Immunodeficiency Syndrome Associate 10419892
Acute Disease Associate 24696530
Adenocarcinoma Associate 30785523, 37713401
Adenocarcinoma of Lung Associate 26264617, 31004093, 34745015, 36157452
Adenocarcinoma of Lung Inhibit 37658534
Adenoma Stimulate 17579859
Adenoma Associate 23442743