Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3592
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 12A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL12A
Synonyms (NCBI Gene) Gene synonyms aliases	CLMF, IL-12A, NFSK, NKSF1, P35
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q25.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030009	hsa-miR-26b-5p	Microarray	19088304
MIRT208864	hsa-miR-21-5p	Microarray, qRT-PCR	22815788
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27571873
MIRT1063591	hsa-miR-1237	CLIP-seq
MIRT1063592	hsa-miR-1248	CLIP-seq
MIRT1063593	hsa-miR-2116	CLIP-seq
MIRT1063594	hsa-miR-3124-3p	CLIP-seq
MIRT1063595	hsa-miR-3163	CLIP-seq
MIRT1063596	hsa-miR-3168	CLIP-seq
MIRT1063597	hsa-miR-340	CLIP-seq
MIRT1063598	hsa-miR-3662	CLIP-seq
MIRT1063599	hsa-miR-3679-3p	CLIP-seq
MIRT1063600	hsa-miR-3973	CLIP-seq
MIRT1063601	hsa-miR-4760-3p	CLIP-seq
MIRT1063602	hsa-miR-520g	CLIP-seq
MIRT1063603	hsa-miR-520h	CLIP-seq
MIRT1063604	hsa-miR-548c-3p	CLIP-seq
MIRT1063605	hsa-miR-549	CLIP-seq
MIRT1063606	hsa-miR-561	CLIP-seq
MIRT1063607	hsa-miR-607	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
IRF1	Unknown	16622221
IRF8	Unknown	16622221
JUN	Unknown	22904313
NFKB1	Activation	18690006
RELA	Activation	18690006

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	1674604, 2204066
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	TAS	1673147
GO:0005143	Function	Interleukin-12 receptor binding	NAS	1674604
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	16456693
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006955	Process	Immune response	TAS	9789052
GO:0007050	Process	Cell cycle arrest	IDA	16942485
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008083	Function	Growth factor activity	NAS	1673147
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016032	Process	Viral process	IEA
GO:0016477	Process	Cell migration	IDA	7903063
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031906	Component	Late endosome lumen	TAS
GO:0032496	Process	Response to lipopolysaccharide	IDA	7605994, 8557999
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	1674604, 11114383, 19088061
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0042163	Function	Interleukin-12 beta subunit binding	IPI	11023671
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12372421
GO:0043514	Component	Interleukin-12 complex	IDA	2204066, 11023671, 11114383
GO:0043514	Component	Interleukin-12 complex	NAS	1674604, 14718574
GO:0045513	Function	Interleukin-27 binding	IPI	9342359
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	2204066
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604, 2204066
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050830	Process	Defense response to Gram-positive bacterium	IEP	1357073
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	25754930

MIM	HGNC	e!Ensembl
161560	5969	ENSG00000168811

Protein

UniProt ID

P29459

Protein name

Interleukin-12 subunit alpha (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL-12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)

Protein function

Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine (PubMed:8605935, PubMed:8943050). IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells

PDB

1F45 , 3HMX , 8XRP , 8YI7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03039	IL12	6 → 219	Interleukin-12 alpha subunit	Domain

Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Sequence length

219

Interactions

View interactions

Show/Hide Unknown Diseases (9)

Disease term	Disease name	Source
Unknown
Celiac disease	Celiac disease	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Biliary Cholangitis	Biliary Cholangitis	GWAS
Multiple Sclerosis	Multiple Sclerosis	GWAS
Mental Depression	Mental Depression	GWAS
Biliary Cirrhosis	Biliary Cirrhosis	GWAS
Bipolar Disorder	Bipolar Disorder	GWAS
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	GWAS
Sarcoidosis	Sarcoidosis	GWAS

Show/Hide Text Mining Associations (72)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32603557
Adenoma	Stimulate	17160410
Anemia	Associate	21107304
Anemia Hemolytic	Associate	20350312
Arthritis Juvenile	Associate	20647273
Asthma	Associate	28600552
Behcet Syndrome	Associate	25799145, 27548383, 32518111, 33393726
Breast Neoplasms	Inhibit	31552680
Carcinoma Hepatocellular	Associate	26631030
Carcinoma Non Small Cell Lung	Associate	25597281
Celiac Disease	Associate	19073967, 20560212, 22087237, 27175695
Cerebral Infarction	Associate	28168424
Clinical Deterioration	Stimulate	25997515
Colitis Collagenous	Associate	31131860
Colorectal Neoplasms	Inhibit	17160410
Colorectal Neoplasms	Associate	26104769
Combined Saposin Deficiency	Associate	20350312
Coronary Artery Disease	Associate	23285065, 24699314, 28321150, 40303485
Coronary Artery Disease	Inhibit	28321150
Critical Illness	Associate	33780352
Cysts	Stimulate	34539639
Death	Associate	28807247
Diabetes Mellitus Type 1	Associate	19073967, 23637351
Disease	Associate	25052311
Drug Hypersensitivity	Stimulate	24785110
Endometrial Hyperplasia	Associate	28951454
Esophageal Neoplasms	Associate	23886125
Esophageal Squamous Cell Carcinoma	Associate	23886125
Graves Disease	Associate	30938833
Helicobacter Infections	Stimulate	26945693
HIV Infections	Inhibit	10419892
Inflammation	Associate	21606320, 23570247, 24955608, 26448050, 27416040, 28168424, 29731755, 36430854, 37400519, 37717172, 40303485
Inflammation	Stimulate	25997515
Inflammatory Bowel Diseases	Associate	25214710
Leukemia Lymphocytic Chronic B Cell	Associate	20952689
Leukemia Myeloid Acute	Associate	32349161
Liver Cirrhosis	Associate	31787974
Liver Cirrhosis Biliary	Associate	19458352, 20639880, 27175695, 28425483
Lung Neoplasms	Associate	25597281, 31552680, 32603557
Lupus Erythematosus Systemic	Associate	28128292
Lymphoma	Associate	21418178, 37329186
Lymphoma B Cell	Associate	26448050
Lymphoma Follicular	Associate	20952689, 21418175
Lymphoma Non Hodgkin	Associate	20952689, 21418175
Lymphoproliferative Disorders	Associate	16449999
Malaria	Associate	20003322
Mastitis	Stimulate	28182101
Melanoma	Associate	39222576
Mouth Diseases	Associate	34539639
Multiple Sclerosis	Associate	24130718
Multiple Sclerosis Relapsing Remitting	Stimulate	22978757
Neoplasms	Inhibit	23570247
Neoplasms	Stimulate	25854372
Neoplasms	Associate	32603557, 37435060, 38278031
Nerve Degeneration	Inhibit	7542648
Neuroendocrine Tumors	Associate	21606320
Obesity	Associate	33487124
Oral Ulcer	Associate	30837455
Prostatic Neoplasms	Associate	37435060
Protein Energy Malnutrition	Associate	38017491
Pulmonary Disease Chronic Obstructive	Associate	22734699
Renal Insufficiency Chronic	Associate	38017491
Severe Acute Respiratory Syndrome	Associate	20350312
Sjogren's Syndrome	Associate	24097067, 30589451
Squamous Cell Carcinoma of Head and Neck	Associate	31815689
Squamous Cell Carcinoma of Head and Neck	Stimulate	37505766
Status Asthmaticus	Associate	28600552
Stomach Neoplasms	Associate	24289573, 33064893
Stomatitis Aphthous	Associate	32518111
Tuberculosis	Associate	19116662
Uterine Cervical Neoplasms	Associate	22614250
Vitamin D Deficiency	Inhibit	36430854

IL12A (interleukin 12A)