Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	3592
Gene name	Interleukin 12A
Gene symbol	IL12A
Synonyms (NCBI Gene)	CLMFIL-12ANFSKNKSF1P35
Chromosome	3
Chromosome location	3q25.33
Summary	This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030009	hsa-miR-26b-5p	Microarray	19088304
MIRT208864	hsa-miR-21-5p	MicroarrayqRT-PCR	22815788
MIRT208864	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25327529
MIRT208864	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	27571873
MIRT1063591	hsa-miR-1237	CLIP-seq
MIRT1063592	hsa-miR-1248	CLIP-seq
MIRT1063593	hsa-miR-2116	CLIP-seq
MIRT1063594	hsa-miR-3124-3p	CLIP-seq
MIRT1063595	hsa-miR-3163	CLIP-seq
MIRT1063596	hsa-miR-3168	CLIP-seq
MIRT1063597	hsa-miR-340	CLIP-seq
MIRT1063598	hsa-miR-3662	CLIP-seq
MIRT1063599	hsa-miR-3679-3p	CLIP-seq
MIRT1063600	hsa-miR-3973	CLIP-seq
MIRT1063601	hsa-miR-4760-3p	CLIP-seq
MIRT1063602	hsa-miR-520g	CLIP-seq
MIRT1063603	hsa-miR-520h	CLIP-seq
MIRT1063604	hsa-miR-548c-3p	CLIP-seq
MIRT1063605	hsa-miR-549	CLIP-seq
MIRT1063606	hsa-miR-561	CLIP-seq
MIRT1063607	hsa-miR-607	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
IRF1	Unknown	16622221
IRF8	Unknown	16622221
JUN	Unknown	22904313
NFKB1	Activation	18690006
RELA	Activation	18690006

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	1674604, 2204066
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	IDA	7584494
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	1673147
GO:0005143	Function	Interleukin-12 receptor binding	IBA
GO:0005143	Function	Interleukin-12 receptor binding	IEA
GO:0005143	Function	Interleukin-12 receptor binding	NAS	1674604
GO:0005515	Function	Protein binding	IDA	10899108
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	10899108
GO:0005615	Component	Extracellular space	IDA	16456693
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9789052
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	NAS	1673147
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016477	Process	Cell migration	IDA	7903063
GO:0031906	Component	Late endosome lumen	TAS
GO:0032496	Process	Response to lipopolysaccharide	IDA	7605994, 8557999
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032729	Process	Positive regulation of type II interferon production	IDA	1674604, 11114383, 19088061
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IBA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775, 7584494, 7638186, 8943050
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7584494, 10899108
GO:0042163	Function	Interleukin-12 beta subunit binding	IPI	11023671
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12372421
GO:0043514	Component	Interleukin-12 complex	IBA
GO:0043514	Component	Interleukin-12 complex	IDA	2204066, 11023671, 11114383
GO:0043514	Component	Interleukin-12 complex	NAS	1674604, 14718574
GO:0045063	Process	T-helper 1 cell differentiation	IDA	14688310
GO:0045513	Function	Interleukin-27 binding	IPI	9342359
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	2204066
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604, 2204066
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050830	Process	Defense response to Gram-positive bacterium	IEP	1357073
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	25754930

MIM	HGNC	e!Ensembl
161560	5969	ENSG00000168811

P29459

Protein name

Interleukin-12 subunit alpha (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL-12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)

Protein function

Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine (PubMed:8605935, PubMed:8943050). IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells

PDB

1F45 , 3HMX , 8XRP , 8YI7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03039	IL12	6 → 219	Interleukin-12 alpha subunit	Domain

Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Sequence length

219

Interactions

View interactions

IL12A (interleukin 12A)