Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8517
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IKBKG
Synonyms (NCBI Gene) Gene synonyms aliases
AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, SAIDX, ZC2HC9
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853321 A>G Pathogenic Terminator codon variant, non coding transcript variant, stop lost
rs137853322 A>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs137853323 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853324 G>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853325 T>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051313 hsa-miR-15a-5p CLASH 23622248
MIRT613718 hsa-miR-8485 HITS-CLIP 21572407
MIRT613714 hsa-miR-4789-3p HITS-CLIP 21572407
MIRT613713 hsa-miR-5580-3p HITS-CLIP 21572407
MIRT613711 hsa-miR-4789-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IPI 17314283
GO:0000922 Component Spindle pole IDA 24561039
GO:0001782 Process B cell homeostasis IEA
GO:0005515 Function Protein binding IPI 9751060, 11113112, 11418127, 11551959, 12486103, 14653779, 14743216, 15474016, 15601829, 15749833, 16126728, 16129692, 16319058, 16874300, 16938294, 17363905, 17363973, 17568778, 17948050, 18266467, 18287044, 18462684, 18583959, 19365808, 19373254, 19666608, 19706536, 19875381, 2001
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300248 5961 ENSG00000269335
Protein
UniProt ID Q9Y6K9
Protein name NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifi
Protein function Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor (PubMed:14695475, PubMed:20724660, PubM
PDB 2JVX , 2JVY , 3BRT , 3BRV , 3CL3 , 3FX0 , 4BWN , 5AAY , 5LDE , 6MI3 , 6MI4 , 6XX0 , 6YEK , 7T2U , 7TV4 , 8U7C , 9AZJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11577 NEMO 44 111 NF-kappa-B essential modulator NEMO Family
PF16516 CC2-LZ 247 344 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
PF18414 zf_C2H2_10 393 418 Domain
Tissue specificity TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK
LDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK
ASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sequence length 419
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ectodermal Dysplasia Ectodermal dysplasia and immunodeficiency 1 rs137853326, rs137853327, rs386134238, rs137853328, rs386134240, rs137853329, rs179363867, rs1569556603, rs782178147, rs2147483647, rs137853324, rs137853325, rs137853330 N/A
Immunodeficiency Immunodeficiency 33 rs137853331, rs137853332, rs179363866, rs2147483647, rs782178147, rs1569556522 N/A
incontinentia pigmenti syndrome Incontinentia pigmenti syndrome rs2071101767, rs137853327, rs2071167272, rs1569556615, rs137853321, rs2070949441, rs782178147, rs137853323, rs1557236796, rs1557236445 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anhidrotic Ectodermal Dysplasia-Immunodeficiency-Osteopetrosis-Lymphedema Syndrome anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome N/A N/A GenCC
Common Variable Immunodeficiency common variable immunodeficiency N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Inhibit 39337357
Alopecia Associate 30659980
Anodontia Associate 30659980
Autoimmune Diseases Associate 22235006
Bacterial Infections Associate 14523047, 29269280
Behcet Syndrome Associate 26812624
Blister Associate 35768795
Brain Diseases Associate 22805531, 27411570
Breast Neoplasms Associate 28402272, 28990063, 32736587
Carcinogenesis Associate 18313693, 19033441, 28931678, 40028213