Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	9641
Gene name	Inhibitor of nuclear factor kappa B kinase subunit epsilon
Gene symbol	IKBKE
Synonyms (NCBI Gene)	IKK-EIKK-iIKKEIKKI
Chromosome	1
Chromosome location	1q32.1
Summary	IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast

189

Show/Hide all (189)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003484	hsa-miR-155-5p	qRT-PCRWestern blot	18753206
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay	19177201
MIRT003484	hsa-miR-155-5p	Review	20026422
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT003484	hsa-miR-155-5p	Proteomics	20584899
MIRT022344	hsa-miR-124-3p	Microarray	18668037
MIRT003484	hsa-miR-155-5p	Luciferase reporter assayWestern blot	24151514
MIRT003484	hsa-miR-155-5p	Luciferase reporter assayWestern blot	24151514
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT003484	hsa-miR-155-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26934326
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063076	hsa-miR-4717-5p	CLIP-seq
MIRT1063077	hsa-miR-4729	CLIP-seq
MIRT1063078	hsa-miR-4753-5p	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550645	hsa-miR-1321	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2550655	hsa-miR-2467-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2550657	hsa-miR-3133	CLIP-seq
MIRT2550658	hsa-miR-3162-5p	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550662	hsa-miR-3188	CLIP-seq
MIRT2550663	hsa-miR-337-3p	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550666	hsa-miR-3975	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550672	hsa-miR-4423-5p	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550678	hsa-miR-4649-3p	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550688	hsa-miR-4739	CLIP-seq
MIRT2550689	hsa-miR-4756-5p	CLIP-seq
MIRT2550690	hsa-miR-4773	CLIP-seq
MIRT2550691	hsa-miR-4781-3p	CLIP-seq
MIRT2550692	hsa-miR-485-5p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550697	hsa-miR-544b	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq
MIRT2682708	hsa-miR-1207-3p	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2682709	hsa-miR-128	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2682710	hsa-miR-1910	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2682711	hsa-miR-27a	CLIP-seq
MIRT2682712	hsa-miR-27b	CLIP-seq
MIRT2682713	hsa-miR-3064-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2682714	hsa-miR-3135b	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	22330135
ZNF382	Repression	20682794

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002218	Process	Activation of innate immune response	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10882136, 12692549, 24882218
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	14743216, 16177806, 16281057, 17568778, 17599067, 17600090, 18636086, 18636090, 19153231, 20188669, 20657822, 21212807, 21903422, 21931555, 22939624, 23096996, 24706939, 25036637, 25852190, 27980081, 28011935, 29251827, 32814053, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20188669
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12692549
GO:0005737	Component	Cytoplasm	IDA	20188669, 24882218
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006950	Process	Response to stress	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	10421793
GO:0006974	Process	DNA damage response	IEA
GO:0008384	Function	IkappaB kinase activity	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IMP	20188669
GO:0010467	Process	Gene expression	IEA
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010884	Process	Positive regulation of lipid storage	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IDA	20188669
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24882218
GO:0031966	Component	Mitochondrial membrane	IMP	16876765
GO:0032481	Process	Positive regulation of type I interferon production	IBA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	18636090
GO:0032481	Process	Positive regulation of type I interferon production	IDA	12692549
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034340	Process	Response to type I interferon	IEA
GO:0035456	Process	Response to interferon-beta	IMP	24882218
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IEA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0042802	Function	Identical protein binding	IPI	24882218
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10882136
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	26934326
GO:0043254	Process	Regulation of protein-containing complex assembly	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0051607	Process	Defense response to virus	NAS	17142768, 21931631
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	23386060
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	17142768, 21931631
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	24882218
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	17142768, 21931631

MIM	HGNC	e!Ensembl
605048	14552	ENSG00000263528

Q14164

Protein name

Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)

Protein function

Serine/threonine kinase that plays an essential role in regulating inflammatory responses to viral infection, through the activation of the type I IFN, NF-kappa-B and STAT signaling. Also involved in TNFA and inflammatory cytokines, like Interle

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	9 → 301	Protein kinase domain	Domain
PF18396	TBK1_ULD	308 → 393	TANK binding kinase 1 ubiquitin-like domain	Domain
PF18394	TBK1_CCD1	400 → 646	TANK-binding kinase 1 coiled-coil domain 1	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.

Sequence

MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV

Sequence length

716

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Autoimmune connective tissue disease and vasculitis	Uncertain significance	rs187136164	RCV001269035
Colon adenocarcinoma	Likely benign	rs189899329	RCV005905006
Malignant tumor of esophagus	Likely benign	rs189899329	RCV005905007
Nonpapillary renal cell carcinoma	Likely benign	rs189899329	RCV005905008
Ovarian cancer	Likely benign	rs189899329	RCV005905009
Thymoma	Likely benign	rs189899329	RCV005905010

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35029906
Anxiety Disorders	Associate	25798331
Aortic Aneurysm	Associate	28198528
Arthritis	Associate	39524436
Autoimmune Diseases	Associate	23944604
Breast Neoplasms	Associate	17574017, 17574021, 19497997, 19940156, 21182093, 23816933, 25833000, 26177467, 28532474, 29801480, 30289335, 32784074, 35121200, 39684488, 40468448
Breast Neoplasms	Stimulate	20863366, 32783398
Carcinogenesis	Associate	22330135, 32784074
Carcinoma Hepatocellular	Associate	25833000
Carcinoma Intraductal Noninfiltrating	Associate	40468448
Carcinoma Non Small Cell Lung	Associate	22330135, 26025939, 27287717
Carcinoma Pancreatic Ductal	Associate	21685032
Carcinoma Renal Cell	Associate	22266464
Carcinoma Small Cell	Associate	26025939
Carcinoma Squamous Cell	Stimulate	26025939
Colorectal Neoplasms	Associate	28523736, 31869529
Coronavirus Infections	Associate	32747502
COVID 19	Inhibit	24622840
Death	Associate	22266464
Depressive Disorder Major	Associate	25798331
Diabetes Mellitus Type 2	Associate	28683283
Fatty Liver	Associate	28683283
Fever	Associate	39524436
Glioblastoma	Stimulate	28677425
Glioma	Associate	29333957, 39352539
Hereditary Autoinflammatory Diseases	Associate	39524436
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21685032
Hodgkin Disease	Associate	19177201
Infections	Stimulate	15367631
Inflammation	Associate	24151514, 25063733, 25798331, 28683283, 32783398, 39524436
Inflammatory Breast Neoplasms	Associate	40468448
Insulin Resistance	Associate	28683283
Lupus Erythematosus Systemic	Associate	32146614, 39524436
Lymphatic Metastasis	Associate	28532474
Mental Disorders	Associate	25798331
Metabolic Diseases	Associate	28683283
Multiple Trauma	Associate	23944604
Neoplasm Metastasis	Associate	25474241, 27574806, 28532474
Neoplasms	Stimulate	17574021, 27145266
Neoplasms	Associate	19497997, 22266464, 26025939, 27574806, 28532474, 30289335, 32783398, 32784074
Obesity	Stimulate	28683283
Oral Ulcer	Associate	39524436
Ovarian Neoplasms	Associate	19497997, 25474241
Panic Disorder	Associate	25798331
Prostatic Neoplasms	Associate	17259348
Pulmonary Disease Chronic Obstructive	Associate	26498252
Sarcoma Kaposi	Associate	30029010
Shock Septic	Associate	10477696
Sjogren's Syndrome	Associate	26380323
Stomach Neoplasms	Associate	27145266, 30487159
Stomatitis Aphthous	Associate	40468448
Triple Negative Breast Neoplasms	Associate	29801480, 31662325
Undiagnosed Diseases	Associate	39524436
Vasculitis	Associate	32146614
Virus Diseases	Associate	21182093, 34908452, 37328105

IKBKE (inhibitor of nuclear factor kappa B kinase subunit epsilon)