IFNA4 (interferon alpha 4)

Gene

• Entrez ID: 3441
• Gene name: Interferon alpha 4
• Gene symbol: IFNA4
• Synonyms (NCBI Gene): IFN-alpha4a, INFA4
• Chromosome: 9
• Chromosome location: 9p21.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1060638	hsa-miR-3121-3p	CLIP-seq
MIRT1060639	hsa-miR-3913-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005132	Function	Type I interferon receptor binding	TAS	3891272
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0009615	Process	Response to virus	TAS	3891272
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

Other IDs

• MIM: 147564
• HGNC: 5425
• e!Ensembl: ENSG00000236637

Protein

• UniProt ID: P05014
• Protein name: Interferon alpha-4 (IFN-alpha-4) (Interferon alpha-4B) (Interferon alpha-76) (Interferon alpha-M1)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
  FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
  ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
  LQKRLRRKD

• Sequence length: 189

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs780149486	RCV004560319
Multisystem inflammatory syndrome in children	risk factor	rs113055208	RCV001779426

Associations from Text Mining
Disease Name	Relationship Type	References
HIV Infections	Stimulate	29762170
Osteoarthritis	Associate	37378023
Osteoporosis	Associate	37361541
Stomach Neoplasms	Associate	33843442