Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3452
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon alpha 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IFNA21
Synonyms (NCBI Gene) Gene synonyms aliases	IFN-alphaI, LeIF F, leIF-F
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016701	hsa-miR-335-5p	Microarray	18185580
MIRT2451614	hsa-miR-203	CLIP-seq
MIRT2451615	hsa-miR-298	CLIP-seq
MIRT2451616	hsa-miR-627	CLIP-seq
MIRT2451617	hsa-miR-924	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005126	Function	Cytokine receptor binding	TAS	6163083
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

MIM	HGNC	e!Ensembl
147584	5424	ENSG00000137080

Protein

UniProt ID

P01568

Protein name

Interferon alpha-21 (IFN-alpha-21) (Interferon alpha-F) (LeIF F)

Protein function

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLE
ACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKI
FQERLRRKE

Sequence length

189

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bronchopulmonary Dysplasia	Associate	37478211
Candidiasis	Associate	36167494
Colorectal Neoplasms	Associate	25350395
Coronary Artery Disease	Associate	21307941, 32248921
Herpes Zoster	Associate	36167494
Inflammation	Associate	32248921
Mucocutaneous Lymph Node Syndrome	Associate	37588055
Otitis Media	Associate	36167494

IFNA21 (interferon alpha 21)