Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3446
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon alpha 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IFNA10
Synonyms (NCBI Gene) Gene synonyms aliases	IFN-alphaC
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002286	Process	T cell activation involved in immune response	IBA	21873635
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005132	Function	Type I interferon receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006959	Process	Humoral immune response	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0030183	Process	B cell differentiation	IBA	21873635
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	21873635
GO:0042100	Process	B cell proliferation	IBA	21873635
GO:0043330	Process	Response to exogenous dsRNA	IBA	21873635
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon signaling pathway	TAS

MIM	HGNC	e!Ensembl
147577	5418	ENSG00000186803

Protein

UniProt ID

P01566

Protein name

Interferon alpha-10 (IFN-alpha-10) (Interferon alpha-6L) (Interferon alpha-C) (LeIF C)

Protein function

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD

Sequence length

189

Interactions

View interactions

IFNA10 (interferon alpha 10)