Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	169355
Gene name Gene Name - the full gene name approved by the HGNC.	Indoleamine 2,3-dioxygenase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IDO2
Synonyms (NCBI Gene) Gene synonyms aliases	INDOL1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments
MIRT1059539	hsa-miR-1827	CLIP-seq
MIRT1059540	hsa-miR-2682	CLIP-seq
MIRT1059541	hsa-miR-34a	CLIP-seq
MIRT1059542	hsa-miR-34c-5p	CLIP-seq
MIRT1059543	hsa-miR-3612	CLIP-seq
MIRT1059544	hsa-miR-432	CLIP-seq
MIRT1059545	hsa-miR-4443	CLIP-seq
MIRT1059546	hsa-miR-449a	CLIP-seq
MIRT1059547	hsa-miR-449b	CLIP-seq
MIRT1059548	hsa-miR-449c	CLIP-seq
MIRT1059549	hsa-miR-4797-3p	CLIP-seq
MIRT1059550	hsa-miR-650	CLIP-seq
MIRT2013861	hsa-miR-489	CLIP-seq
MIRT2013862	hsa-miR-514	CLIP-seq
MIRT2013863	hsa-miR-514b-3p	CLIP-seq
MIRT2246042	hsa-miR-579	CLIP-seq
MIRT2246043	hsa-miR-664	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PTMA	Activation	21176371;21575365

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS	17499941
GO:0005829	Component	Cytosol	TAS
GO:0006569	Process	Tryptophan catabolic process	TAS
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IBA	21873635
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IDA	17671174
GO:0019441	Process	Tryptophan catabolic process to kynurenine	IEA
GO:0019441	Process	Tryptophan catabolic process to kynurenine	ISS	17499941
GO:0020037	Function	Heme binding	IEA
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IBA	21873635
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IDA	17671174
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	ISS	17499941
GO:0034354	Process	'de novo' NAD biosynthetic process from tryptophan	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
612129	27269	ENSG00000188676

Protein

UniProt ID

Q6ZQW0

Protein name

Indoleamine 2,3-dioxygenase 2 (IDO-2) (EC 1.13.11.-) (Indoleamine 2,3-dioxygenase-like protein 1) (Indoleamine-pyrrole 2,3-dioxygenase-like protein 1)

Protein function

Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway (PubMed:17671174). Involved in immune regulation. May not play a significant role in tryptophan-related tumoral resi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01231	IDO	28 → 414	Indoleamine 2,3-dioxygenase	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in liver, small intestine, spleen, placenta, thymus, lung, brain, kidney, and colon (PubMed:17671174). Also expressed at low level in testis and thyroid. Not expressed in the majority of human tumor samples (>99%) (PubMed:2569

Sequence

MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA
NKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVL
PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGF
ILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDP
DIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYH
ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG

Sequence length

420

Interactions

View interactions

IDO2 (indoleamine 2,3-dioxygenase 2)