IDH3G (isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit gamma)

Gene

• Entrez ID: 3421
• Gene name: Isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit gamma
• Gene symbol: IDH3G
• Synonyms (NCBI Gene): H-IDHG, RP99
• Chromosome: X
• Chromosome location: Xq28
• Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044581	hsa-miR-320a	CLASH	23622248
MIRT2246020	hsa-miR-4514	CLIP-seq
MIRT2246021	hsa-miR-4692	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	28098230
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004449	Function	Isocitrate dehydrogenase (NAD+) activity	ISS
GO:0004449	Function	Isocitrate dehydrogenase (NAD+) activity	TAS	9286695
GO:0005515	Function	Protein binding	IPI	14555658, 28098230, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005739	Component	Mitochondrion	NAS	14555658
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005975	Process	Carbohydrate metabolic process	NAS	9286695
GO:0006099	Process	Tricarboxylic acid cycle	IBA
GO:0006099	Process	Tricarboxylic acid cycle	IDA	14555658
GO:0006099	Process	Tricarboxylic acid cycle	IEA
GO:0006102	Process	Isocitrate metabolic process	IBA
GO:0006102	Process	Isocitrate metabolic process	ISS
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0045242	Component	Isocitrate dehydrogenase complex (NAD+)	IDA	14555658
GO:0045242	Component	Isocitrate dehydrogenase complex (NAD+)	IPI	14555658
GO:0046872	Function	Metal ion binding	IEA
GO:0051287	Function	NAD binding	IEA

Other IDs

• MIM: 300089
• HGNC: 5386
• e!Ensembl: ENSG00000067829

Protein

• UniProt ID: P51553
• Protein name: Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Isocitric dehydrogenase subunit gamma) (NAD(+)-specific ICDH subunit gamma)
• Protein function: Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterod
• PDB: 5GRE, 5GRF, 5GRH, 5GRI, 5GRL, 5YVT, 6L57, 6L59, 7CE3, 8GRG, 8GRH, 8GS5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00180	Iso_dh	56 → 382	Isocitrate/isopropylmalate dehydrogenase	Domain

• Sequence:

  MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMI
  PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
  NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
  SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
  ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
  HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
  MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA

• Sequence length: 393

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Spastic quadriplegic cerebral palsy	Uncertain significance	rs2092091803	RCV001262473

Associations from Text Mining
Disease Name	Relationship Type	References
Diabetes Mellitus	Associate	36187097
Retinitis Pigmentosa	Associate	40119724
Retinitis Pigmentosa 2	Associate	40119724