Gene Gene information from NCBI Gene database.
Entrez ID 3159
Gene name High mobility group AT-hook 1
Gene symbol HMGA1
Synonyms (NCBI Gene)
HMG-RHMGA1AHMGIY
Chromosome 6
Chromosome location 6p21.31
Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove o
miRNA miRNA information provided by mirtarbase database.
724
miRTarBase ID miRNA Experiments Reference
MIRT000349 hsa-miR-125b-5p Luciferase reporter assay 17563749
MIRT000110 hsa-miR-26a-5p Luciferase reporter assay 17563749
MIRT003152 hsa-let-7a-5p Luciferase reporter assayqRT-PCR 19179606
MIRT003152 hsa-let-7a-5p Luciferase reporter assayqRT-PCR 19179606
MIRT001625 hsa-let-7b-5p pSILAC 18668040
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
E2F1 Activation 22389255
MYCN Unknown 16166307
SP1 Activation 17510387
SP1 Unknown 22389255
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
56
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 9253416
GO:0001221 Function Transcription coregulator binding IDA 10428834
GO:0003677 Function DNA binding EXP 9253416, 22615915
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600701 5010 ENSG00000137309
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17096
Protein name High mobility group protein HMG-I/HMG-Y (HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1) (High mobility group protein R)
Protein function HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the
PDB 2EZD , 2EZE , 2EZF , 2EZG , 8CPG
Family and domains
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Sequence length 107
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Likely benign rs143690346 RCV005937516
Diabetes mellitus type 2, susceptibility to Benign rs139876191 RCV002284223
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27027341
Adenocarcinoma Associate 27484584
Adenocarcinoma Follicular Stimulate 10714095
Adenocarcinoma of Lung Stimulate 24564251
Adenocarcinoma of Lung Associate 27025651, 28000891, 30353687, 33684161, 35805937
Adenoma Stimulate 30999005
Alzheimer Disease Associate 17903177, 20194618
Brain Neoplasms Associate 31116627
Breast Neoplasms Associate 17290307, 22932725, 23658826, 25572132, 25755724, 26265440, 26527623, 27723831, 28924209, 31167352, 31531802, 35504904, 36614035
Calcinosis Cutis Associate 23658826