Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27165
Gene name Gene Name - the full gene name approved by the HGNC.	Glutaminase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GLS2
Synonyms (NCBI Gene) Gene synonyms aliases	GA, GLS, LGA, hLGA
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in othe

Show/Hide all(59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016977	hsa-miR-335-5p	Microarray	18185580
MIRT734755	hsa-miR-1246	Microarray, qRT-PCR	33610185
MIRT734756	hsa-miR-1260a	Microarray, qRT-PCR	33610185
MIRT734757	hsa-miR-146a-5p	Microarray, qRT-PCR	33610185
MIRT734758	hsa-miR-21-5p	Microarray, qRT-PCR	33610185
MIRT1021506	hsa-miR-103a	CLIP-seq
MIRT1021507	hsa-miR-107	CLIP-seq
MIRT1021508	hsa-miR-1193	CLIP-seq
MIRT1021509	hsa-miR-1262	CLIP-seq
MIRT1021510	hsa-miR-15a	CLIP-seq
MIRT1021511	hsa-miR-15b	CLIP-seq
MIRT1021512	hsa-miR-16	CLIP-seq
MIRT1021513	hsa-miR-195	CLIP-seq
MIRT1021514	hsa-miR-2052	CLIP-seq
MIRT1021515	hsa-miR-3125	CLIP-seq
MIRT1021516	hsa-miR-3127-5p	CLIP-seq
MIRT1021517	hsa-miR-3150b-3p	CLIP-seq
MIRT1021518	hsa-miR-3661	CLIP-seq
MIRT1021519	hsa-miR-3916	CLIP-seq
MIRT1021520	hsa-miR-424	CLIP-seq
MIRT1021521	hsa-miR-4270	CLIP-seq
MIRT1021522	hsa-miR-4274	CLIP-seq
MIRT1021523	hsa-miR-4441	CLIP-seq
MIRT1021524	hsa-miR-4487	CLIP-seq
MIRT1021525	hsa-miR-4519	CLIP-seq
MIRT1021526	hsa-miR-4524	CLIP-seq
MIRT1021527	hsa-miR-4687-3p	CLIP-seq
MIRT1021528	hsa-miR-4701-3p	CLIP-seq
MIRT1021529	hsa-miR-4709-3p	CLIP-seq
MIRT1021530	hsa-miR-4784	CLIP-seq
MIRT1021531	hsa-miR-497	CLIP-seq
MIRT1021532	hsa-miR-503	CLIP-seq
MIRT1021533	hsa-miR-561	CLIP-seq
MIRT1021534	hsa-miR-631	CLIP-seq
MIRT1021535	hsa-miR-646	CLIP-seq
MIRT1021536	hsa-miR-769-5p	CLIP-seq
MIRT2002697	hsa-miR-3675-3p	CLIP-seq
MIRT1021506	hsa-miR-103a	CLIP-seq
MIRT1021507	hsa-miR-107	CLIP-seq
MIRT1021510	hsa-miR-15a	CLIP-seq
MIRT1021511	hsa-miR-15b	CLIP-seq
MIRT1021512	hsa-miR-16	CLIP-seq
MIRT1021513	hsa-miR-195	CLIP-seq
MIRT1021520	hsa-miR-424	CLIP-seq
MIRT1021522	hsa-miR-4274	CLIP-seq
MIRT1021525	hsa-miR-4519	CLIP-seq
MIRT1021526	hsa-miR-4524	CLIP-seq
MIRT1021531	hsa-miR-497	CLIP-seq
MIRT1021532	hsa-miR-503	CLIP-seq
MIRT1021535	hsa-miR-646	CLIP-seq
MIRT1021515	hsa-miR-3125	CLIP-seq
MIRT1021517	hsa-miR-3150b-3p	CLIP-seq
MIRT1021518	hsa-miR-3661	CLIP-seq
MIRT1021519	hsa-miR-3916	CLIP-seq
MIRT1021521	hsa-miR-4270	CLIP-seq
MIRT1021523	hsa-miR-4441	CLIP-seq
MIRT1021530	hsa-miR-4784	CLIP-seq
MIRT1021534	hsa-miR-631	CLIP-seq
MIRT1021536	hsa-miR-769-5p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004359	Function	Glutaminase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11163757, 32296183
GO:0005739	Component	Mitochondrion	IDA	20351271
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006520	Process	Cellular amino acid metabolic process	TAS	10620514
GO:0006537	Process	Glutamate biosynthetic process	IBA	21873635
GO:0006543	Process	Glutamine catabolic process	IBA	21873635
GO:0008652	Process	Cellular amino acid biosynthetic process	TAS
GO:0014047	Process	Glutamate secretion	TAS
GO:0042981	Process	Regulation of apoptotic process	IMP	20351271
GO:0072593	Process	Reactive oxygen species metabolic process	IMP	20351271

MIM	HGNC	e!Ensembl
606365	29570	ENSG00000135423

Protein

UniProt ID

Q9UI32

Protein name

Glutaminase liver isoform, mitochondrial (GLS) (EC 3.5.1.2) (L-glutaminase) (L-glutamine amidohydrolase)

Protein function

Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant functio

PDB

4BQM , 5U0K , 8SZL , 8T0Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17959	EF-hand_14	72 → 155	EF-hand domain	Domain
PF04960	Glutaminase	177 → 463	Glutaminase	Domain
PF12796	Ank_2	484 → 582	Ankyrin repeats (3 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver. Expressed in brain and pancreas. Not observed in heart, placenta, lung, skeletal muscle and kidney. Expression is significantly reduced in hepatocellular carcinomas. {ECO:0000269|PubMed:10620514, ECO:0000269|

Sequence

MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EIRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLES
MV

Sequence length

602

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Gout	Gout			GWAS

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	35509981
Atherosclerosis	Associate	36658621
Brain Diseases	Associate	23384343
Carcinogenesis	Associate	26751560
Carcinoma Hepatocellular	Inhibit	20378837, 24330717
Carcinoma Hepatocellular	Associate	25844758, 27079415, 36042180
Cardiomegaly	Associate	37277029
Colonic Neoplasms	Stimulate	23574722
Colorectal Neoplasms	Associate	24330717
Diabetic Foot	Associate	38287255, 40024299
Epilepsy Temporal Lobe	Stimulate	23384343
Glaucoma	Associate	33137197
Glioblastoma	Associate	22888977, 24096582, 28939850, 39796278
Glioma	Inhibit	22888977
Glioma	Associate	24276018
Hepatic Encephalopathy	Associate	25880019
Liver Cirrhosis	Associate	40550888
Liver Diseases	Associate	40550888
Nasopharyngeal Carcinoma	Associate	36732567
Neoplasm Metastasis	Inhibit	26751560
Neoplasms	Associate	10620514, 23574722, 25026281, 28811348, 31526853, 31668020, 33746066
Neoplasms	Inhibit	20378837, 26751560, 33610185, 39796278
Oncogene Addiction	Associate	28811348
Pancreatic Neoplasms	Inhibit	37369808
Sclerosis	Stimulate	23384343

GLS2 (glutaminase 2)