GAD2 (glutamate decarboxylase 2)

Gene

• Entrez ID: 2572
• Gene name: Glutamate decarboxylase 2
• Gene symbol: GAD2
• Synonyms (NCBI Gene): GAD65
• Chromosome: 10
• Chromosome location: 10p12.1
• Summary: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A path

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0004351	Function	Glutamate decarboxylase activity	IBA
GO:0004351	Function	Glutamate decarboxylase activity	IEA
GO:0005515	Function	Protein binding	IPI	10671565, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006540	Process	Gamma-aminobutyrate shunt	IBA
GO:0006540	Process	Gamma-aminobutyrate shunt	TAS	1549570
GO:0007268	Process	Chemical synaptic transmission	TAS	8954991
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	IBA
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0016830	Function	Carbon-carbon lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030424	Component	Axon	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0061202	Component	Clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS

Other IDs

• MIM: 138275
• HGNC: 4093
• e!Ensembl: ENSG00000136750

Protein

• UniProt ID: Q05329
• Protein name: Glutamate decarboxylase 2 (EC 4.1.1.15) (65 kDa glutamic acid decarboxylase) (GAD-65) (Glutamate decarboxylase 65 kDa isoform)
• Protein function: Catalyzes the production of GABA.
• PDB: 1ES0, 2OKK, 7LZ6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00282	Pyridoxal_deC	138 → 509	Pyridoxal-dependent decarboxylase conserved domain	Domain

• Sequence:

  MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
  SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
  YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
  QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
  PGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
  LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
  MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
  MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
  LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
  GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL

• Sequence length: 585

<