Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92579
Gene name Gene Name - the full gene name approved by the HGNC.
Glucose-6-phosphatase catalytic subunit 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
G6PC3
Synonyms (NCBI Gene) Gene synonyms aliases
SCN4, UGRP
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogeno
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34019455 ->C Pathogenic Non coding transcript variant, frameshift variant, coding sequence variant, 3 prime UTR variant
rs118203968 G>A Pathogenic 3 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant
rs118203969 T>C Pathogenic Coding sequence variant, synonymous variant, non coding transcript variant, missense variant
rs118203970 C>G,T Pathogenic 5 prime UTR variant, intron variant, upstream transcript variant, stop gained, coding sequence variant, synonymous variant, genic upstream transcript variant, non coding transcript variant
rs118203971 G>C Pathogenic 3 prime UTR variant, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003103 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR 19296470
MIRT022062 hsa-miR-128-3p Microarray 17612493
MIRT003103 hsa-miR-122-5p Microarray 17612493
MIRT039531 hsa-miR-652-3p CLASH 23622248
MIRT1009012 hsa-miR-185 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004346 Function Glucose-6-phosphatase activity EXP 14718531
GO:0004346 Function Glucose-6-phosphatase activity IBA
GO:0004346 Function Glucose-6-phosphatase activity IEA
GO:0004346 Function Glucose-6-phosphatase activity IMP 25492228
GO:0004346 Function Glucose-6-phosphatase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611045 24861 ENSG00000141349
Protein
UniProt ID Q9BUM1
Protein name Glucose-6-phosphatase 3 (G-6-Pase 3) (G6Pase 3) (EC 3.1.3.9) (Glucose-6-phosphatase beta) (G6Pase-beta) (Ubiquitous glucose-6-phosphatase catalytic subunit-related protein)
Protein function Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. May form with the glucose-6-phosphate transporter (SLC37A4/G6PT) a ubiquitously expressed complex responsible for glucose production through glycogenolysis and gluconeogenes
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 37 195 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in skeletal muscle, at intermediate levels in heart, brain, placenta, kidney, colon, thymus, spleen and pancreas. Also detected in testis, prostate, ovary, liver, lung, small intestine and perip
Sequence
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGA
VLGWLMTPRVPMERE
LSFYGLTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEW
IHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL
GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
Sequence length 346
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Congenital Neutropenia autosomal recessive severe congenital neutropenia due to g6pc3 deficiency rs1194477276, rs118203968, rs745582203, rs118203969, rs1191239079, rs118203970, rs1597905369, rs118203971, rs267606834, rs34019455, rs200478425, rs775224457, rs769441127, rs148559256, rs797044567 N/A
Immunodeficiency Inherited Immunodeficiency Diseases rs34019455 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Albinism Oculocutaneous Associate 21677667
Asthma Associate 34305938
Brain Neoplasms Associate 38034009
Central Nervous System Vascular Malformations Associate 25391451
Congenital Abnormalities Associate 25491320
Craniosynostoses Associate 20220065
Crohn Disease Associate 23171239, 25491320, 31157858
Cryptorchidism Associate 34305938
Death Associate 25491320
Death Sudden Associate 25491320