Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2534
Gene name Gene Name - the full gene name approved by the HGNC.	FYN proto-oncogene, Src family tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FYN
Synonyms (NCBI Gene) Gene synonyms aliases	SLK, SYN, p59-FYN
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022048	hsa-miR-128-3p	Microarray	17612493
MIRT038910	hsa-miR-93-3p	CLASH	23622248
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	27520374
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	27520374
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT1007638	hsa-miR-3159	CLIP-seq
MIRT1007639	hsa-miR-33a	CLIP-seq
MIRT1007640	hsa-miR-33b	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq

Show/Hide all(119)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000304	Process	Response to singlet oxygen	ISS	27525436
GO:0001764	Process	Neuron migration	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 11448999, 12923167, 18697750, 27692963
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IMP	16979591
GO:0004713	Function	Protein tyrosine kinase activity	ISS	17526495
GO:0004713	Function	Protein tyrosine kinase activity	TAS	17526495, 28386764
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	7822789
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	1661130, 1715582, 7685273, 7687537, 9045636, 9195899, 9360983, 9763511, 10209036, 10383400, 10409671, 10790433, 10867021, 11741929, 12721299, 12788081, 14757743, 14993658, 15784897, 16115884, 16374509, 16479011, 16636290, 16713569, 16777849, 16831868, 16899217, 16964398, 16966330, 17
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005768	Component	Endosome	IDA	15611048
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IDA	12150984, 15611048
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	NAS	7822789
GO:0006468	Process	Protein phosphorylation	TAS	25707991
GO:0006816	Process	Calcium ion transport	NAS	7822789
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007411	Process	Axon guidance	TAS
GO:0007596	Process	Blood coagulation	TAS
GO:0007612	Process	Learning	TAS	1361685
GO:0007631	Process	Feeding behavior	TAS	8264796
GO:0008360	Process	Regulation of cell shape	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	ISS	27525436
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	16979591, 27520374
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS	27525436
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	TAS	25707991
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	27525436
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030425	Component	Dendrite	ISS
GO:0030900	Process	Forebrain development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	1361685
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IEA
GO:0042542	Process	Response to hydrogen peroxide	ISS	27525436
GO:0042608	Function	T cell receptor binding	IEA
GO:0042609	Function	CD4 receptor binding	IEA
GO:0042610	Function	CD8 receptor binding	IEA
GO:0042802	Function	Identical protein binding	IPI	14993658, 25156556, 27001024
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0044297	Component	Cell body	ISS
GO:0044325	Function	Ion channel binding	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	12150984
GO:0045121	Component	Membrane raft	IMP	23386614
GO:0045121	Component	Membrane raft	ISS
GO:0045121	Component	Membrane raft	TAS	28386764
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	10498895
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048156	Function	Tau protein binding	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048156	Function	Tau protein binding	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	IDA	7722293
GO:0050900	Process	Leukocyte migration	TAS
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070851	Function	Growth factor receptor binding	IPI	16479011
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0097062	Process	Dendritic spine maintenance	TAS	25707991
GO:0097386	Component	Glial cell projection	ISS
GO:0097718	Function	Disordered domain specific binding	IPI	9351809
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900449	Process	Regulation of glutamate receptor signaling pathway	ISS
GO:1901216	Process	Positive regulation of neuron death	ISS
GO:1902951	Process	Negative regulation of dendritic spine maintenance	ISS
GO:1903202	Process	Negative regulation of oxidative stress-induced cell death	ISS	27525436
GO:1903997	Process	Positive regulation of non-membrane spanning protein tyrosine kinase activity	TAS
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IMP	27520374
GO:1905232	Process	Cellular response to L-glutamate	ISS	17526495
GO:1905430	Process	Cellular response to glycine	ISS	17526495
GO:1905477	Process	Positive regulation of protein localization to membrane	TAS	28386764
GO:1905664	Process	Regulation of calcium ion import across plasma membrane	ISS
GO:2001056	Process	Positive regulation of cysteine-type endopeptidase activity	ISS	17526495
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
137025	4037	ENSG00000010810

Protein

UniProt ID

P06241

Protein name

Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)

Protein function

Non-receptor tyrosine-protein kinase that plays a role in many biological processes including regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon gu

PDB

1A0N , 1AOT , 1AOU , 1AVZ , 1AZG , 1EFN , 1FYN , 1G83 , 1M27 , 1NYF , 1NYG , 1SHF , 1ZBJ , 2DQ7 , 2MQI , 2MRJ , 2MRK , 3H0F , 3H0H , 3H0I , 3UA6 , 3UA7 , 4D8D , 4EIK , 4U17 , 4U1P , 4ZNX , 5ZAU , 6EDF , 6IPY , 6IPZ , 7A2J , 7A2K , 7A2L , 7A2M , 7A2N , 7A2O , 7A2P , 7A2Q , 7A2R , 7A2S , 7A2T , 7A2U , 7A2V , 7A2W , 7A2X , 7A2Y , 7A2Z , 7UD6 , 8KDX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	88 → 135	SH3 domain	Domain
PF00017	SH2	149 → 231	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	271 → 520	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is highly expressed in the brain. Isoform 2 is expressed in cells of hemopoietic lineages, especially T-lymphocytes. {ECO:0000269|PubMed:10196263}.

Sequence

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

Sequence length

537

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Hypothyroidism	Hypothyroidism	GWAS
Schizophrenia	Schizophrenia	GWAS
Bipolar Disorder	Bipolar Disorder	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	GWAS
Psoriasis	Psoriasis	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (81)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Inhibit	8823293
Adenocarcinoma of Lung	Associate	29266838
Alzheimer Disease	Associate	22927204, 28033507, 32751526, 35563596, 36258016
Aneuploidy	Associate	19404734
Arthritis Rheumatoid	Associate	33430905
Ataxia Telangiectasia	Associate	11315256
Autistic Disorder	Associate	36039581
Bone Resorption	Associate	9844106
Breast Neoplasms	Associate	19404734, 21480388, 37958964
Calcinosis Cutis	Associate	26493492
Carcinogenesis	Stimulate	29453318
Carcinogenesis	Associate	33987980
Carcinoma Hepatocellular	Associate	39795978
Carcinoma Ovarian Epithelial	Associate	36708583
Carcinoma Pancreatic Ductal	Associate	36905103
Carcinoma Renal Cell	Associate	36708583
Cerebral Hemorrhage	Associate	30836997
Cholangiocarcinoma	Associate	25526346
Chondrosarcoma	Associate	23922104
Chromosome Disorders	Associate	19404734
Cleft Lip	Associate	30127215
Colorectal Neoplasms	Associate	18805444, 29693170, 32811808, 33987980, 36510452
Dementia	Associate	35327643, 36258016
Diabetes Gestational	Associate	33890634
Diabetes Mellitus Type 1	Associate	24098138
Diabetic Nephropathies	Associate	28990106
Diabetic Retinopathy	Associate	38194422
Diffuse Neurofibrillary Tangles with Calcification	Associate	28033507
Frontotemporal Lobar Degeneration	Associate	36258016
Genetic Diseases Inborn	Associate	24413734
Glioblastoma	Associate	22323579, 26136341, 39946771
Glioma	Associate	21480388
HIV Infections	Inhibit	8823293
Hodgkin Disease	Associate	12881301
Hyperplasia	Stimulate	11477536
Idiopathic Pulmonary Fibrosis	Inhibit	33325804
Inflammation	Associate	29693170, 38194422
Ischemic Stroke	Associate	32945445
Keratoconus	Associate	37965330
Leukemia	Associate	27566560, 28978570
Leukemia Large Granular Lymphocytic	Associate	27566560
Leukemia Lymphocytic Chronic B Cell	Inhibit	32986360
Leukemia Lymphoma Adult T Cell	Associate	28978570
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19131339, 21480388, 26136341
Leukemia T Cell	Stimulate	9045636
Lymphoma T Cell Peripheral	Inhibit	23716562
Metabolic Diseases	Associate	35240786
Multiple Myeloma	Associate	14717778, 9217182
Multiple Sclerosis	Associate	23469041
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	33242826
Nasopharyngeal Carcinoma	Associate	37274867
Neoplasm Invasiveness	Associate	26549256
Neoplasm Metastasis	Associate	24597767, 26493492, 28944885
Neoplasms	Inhibit	12450793
Neoplasms	Associate	12881301, 18990162, 20233874, 21480388, 24597767, 26001218, 26136341, 27566560, 29307797, 31189776, 39241280, 7829390, 9490199, 9531350
Neoplasms	Stimulate	26549256
Neoplasms Cystic Mucinous and Serous	Associate	36708583
Neuroblastoma	Associate	12450793
Neuroinflammatory Diseases	Associate	30836997
Neurotoxicity Syndromes	Associate	16864581
Obesity	Associate	26646899, 34964707
Osteoarthritis	Associate	37140355
Osteoblastoma	Associate	31467230
Pancreatic Neoplasms	Associate	33213062
Pancreatitis	Associate	21480388
Prostatic Neoplasms	Stimulate	18990162
Prostatic Neoplasms	Associate	37771187
Prostatic Neoplasms Castration Resistant	Stimulate	26493492
Prostatitis	Associate	21480388
Psoriasis	Associate	24303025
Pulmonary Fibrosis	Associate	33325804
Radiation Injuries	Associate	36530656
Sarcoma	Associate	35839307
Squamous Cell Carcinoma of Head and Neck	Associate	12771142, 24192080
Stomach Neoplasms	Associate	16367923, 26811494
Subarachnoid Hemorrhage	Associate	36214715
Tauopathies	Associate	28033507
Thyroiditis Autoimmune	Associate	37197658
Urinary Bladder Neoplasms	Associate	26786295, 36530656
Uveal melanoma	Associate	24597767
Virus Diseases	Associate	23405030

FYN (FYN proto-oncogene, Src family tyrosine kinase)