Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	486
Gene name Gene Name - the full gene name approved by the HGNC.	FXYD domain containing ion transport regulator 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FXYD2
Synonyms (NCBI Gene) Gene synonyms aliases	ATP1G1, HOMG2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HOMG2
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019415	hsa-miR-148b-3p	Microarray	17612493
MIRT022024	hsa-miR-128-3p	Microarray	17612493
MIRT444235	hsa-miR-941	PAR-CLIP	22100165
MIRT444234	hsa-miR-4453	PAR-CLIP	22100165
MIRT444233	hsa-miR-4538	PAR-CLIP	22100165
MIRT444232	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT444231	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT444230	hsa-miR-4999-5p	PAR-CLIP	22100165
MIRT444235	hsa-miR-941	PAR-CLIP	22100165
MIRT444234	hsa-miR-4453	PAR-CLIP	22100165
MIRT444233	hsa-miR-4538	PAR-CLIP	22100165
MIRT444232	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT444231	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT444230	hsa-miR-4999-5p	PAR-CLIP	22100165
MIRT1007429	hsa-miR-1270	CLIP-seq
MIRT1007430	hsa-miR-138	CLIP-seq
MIRT1007431	hsa-miR-185	CLIP-seq
MIRT1007432	hsa-miR-3126-5p	CLIP-seq
MIRT1007433	hsa-miR-323-5p	CLIP-seq
MIRT1007434	hsa-miR-3921	CLIP-seq
MIRT1007435	hsa-miR-4306	CLIP-seq
MIRT1007436	hsa-miR-432	CLIP-seq
MIRT1007437	hsa-miR-4419a	CLIP-seq
MIRT1007438	hsa-miR-4456	CLIP-seq
MIRT1007439	hsa-miR-4510	CLIP-seq
MIRT1007440	hsa-miR-4531	CLIP-seq
MIRT1007441	hsa-miR-4644	CLIP-seq
MIRT1007442	hsa-miR-4653-5p	CLIP-seq
MIRT1007443	hsa-miR-4710	CLIP-seq
MIRT1007444	hsa-miR-485-5p	CLIP-seq
MIRT1007445	hsa-miR-503	CLIP-seq
MIRT1007446	hsa-miR-593	CLIP-seq
MIRT1007447	hsa-miR-620	CLIP-seq
MIRT1007448	hsa-miR-876-3p	CLIP-seq
MIRT1998507	hsa-miR-1207-3p	CLIP-seq
MIRT2388271	hsa-miR-34a	CLIP-seq
MIRT2388272	hsa-miR-34c-5p	CLIP-seq
MIRT2388273	hsa-miR-449a	CLIP-seq
MIRT2388274	hsa-miR-449b	CLIP-seq
MIRT2388275	hsa-miR-518e	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HNF1B	Unknown	24204001
PCBD1	Repression	24204001

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005890	Component	Sodium:potassium-exchanging ATPase complex	ISS
GO:0017080	Function	Sodium channel regulator activity	IBA	21873635
GO:0030674	Function	Protein-macromolecule adaptor activity	ISS
GO:0032781	Process	Positive regulation of ATPase activity	IEA
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0036376	Process	Sodium ion export across plasma membrane	ISS
GO:0055085	Process	Transmembrane transport	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0099106	Function	Ion channel regulator activity	IEA
GO:1903408	Process	Positive regulation of sodium:potassium-exchanging ATPase activity	ISS
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1990573	Process	Potassium ion import across plasma membrane	ISS
GO:2000649	Process	Regulation of sodium ion transmembrane transporter activity	IBA	21873635

MIM	HGNC	e!Ensembl
601814	4026	ENSG00000137731

Protein

UniProt ID

P54710

Protein name

Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain)

Protein function

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

PDB

2MKV , 7E1Z , 7E20 , 7E21

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02038	ATP1G1_PLM_MAT8	14 → 60	ATP1G1/PLM/MAT8 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Sequence

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP

Sequence length

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Hyperopia	Hyperopia	GWAS
Myopia	Myopia	GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma Chromophobe	Stimulate	23196795
Bartter Syndrome Type 3 with Hypocalciuria	Associate	19389850, 19865785, 25765846
Carcinogenesis	Associate	36313180
Carcinoma Renal Cell	Inhibit	36313180
Chondrocalcinosis	Associate	25765846
Colorectal Neoplasms	Associate	34270462
Fructose and Galactose Intolerance	Associate	40428357
Gitelman Syndrome	Associate	34607911
Glioma	Associate	34753441
Glycosuria Renal	Associate	34607911
Hypomagnesemia primary	Associate	19389850
Kidney Diseases	Associate	40428357
Macrothrombocytopenia Autosomal Dominant Tubb1 Related	Associate	25765846
Multiple Pterygium Syndrome Autosomal Dominant	Associate	25765846
Neoplasms	Inhibit	26910837
Oligodendroglioma	Associate	34753441
Ovarian Neoplasms	Stimulate	26910837, 38494731
Proteinuria	Associate	40428357

FXYD2 (FXYD domain containing ion transport regulator 2)