Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2309
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box O3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXO3
Synonyms (NCBI Gene) Gene synonyms aliases
AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000671 hsa-miR-182-5p Luciferase reporter assay, Western blot 19188590
MIRT000671 hsa-miR-182-5p Luciferase reporter assay, Western blot 19188590
MIRT000671 hsa-miR-182-5p Review 19935707
MIRT004495 hsa-miR-155-5p qRT-PCR, Luciferase reporter assay, Western blot 20371610
MIRT000434 hsa-miR-221-3p qRT-PCR, ChIP, Luciferase reporter assay, Western blot, Northern blot 20388878
Transcription factors
Transcription factor Regulation Reference
ABL1 Activation 15509806
NFKB1 Unknown 19299143
RELA Unknown 19299143
SIRT1 Repression 17558024;21841822
SIRT3 Unknown 23665396
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18393360, 20371612, 21621563
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18787191
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602681 3821 ENSG00000118689
Protein
UniProt ID O43524
Protein name Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1)
Protein function Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy (PubMed:10102273, PubMed:16751106, PubMed:21329882, PubMed:30513302). Acts as a positi
PDB 2K86 , 2LQH , 2LQI , 2UZK , 6MNL , 7V9B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 157 244 Forkhead domain Domain
PF16675 FOXO_KIX_bdg 432 511 KIX-binding domain of forkhead box O, CR2 Family
PF16676 FOXO-TAD 604 645 Transactivation domain of FOXO protein family Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9479491}.
Sequence
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSG
KAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVML
RNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
Sequence length 673
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Choroid Plexus Carcinoma choroid plexus carcinoma N/A N/A ClinVar
Crohn Disease Poor prognosis in Crohn's disease N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Medulloblastoma medulloblastoma N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 28139510
Adenocarcinoma of Lung Inhibit 24014251
Adenocarcinoma of Lung Associate 24766860, 25743813
Alzheimer Disease Associate 34475505, 36988771, 37483002
Amyloidosis Associate 37039144
Anemia Sickle Cell Associate 29884740
Arthritis Rheumatoid Associate 30429437, 30679758, 35008549
Arthritis Rheumatoid Inhibit 39498523, 40238799
Asthma Associate 29141605, 33298101, 35501805, 36675122
Ataxia Telangiectasia Associate 37345209