Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2308
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box O1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXO1
Synonyms (NCBI Gene) Gene synonyms aliases
FKH1, FKHR, FOXO1A
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. T
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001088 hsa-miR-27a-3p qRT-PCR, Luciferase reporter assay, Western blot 19574223
MIRT001087 hsa-miR-96-5p qRT-PCR, Luciferase reporter assay, Western blot 19574223
MIRT001086 hsa-miR-182-5p qRT-PCR, Luciferase reporter assay, Western blot 19574223
MIRT001086 hsa-miR-182-5p Luciferase reporter assay 19574223
MIRT001088 hsa-miR-27a-3p Luciferase reporter assay 19574223
Transcription factors
Transcription factor Regulation Reference
FOXC1 Unknown 17993506;21837767
KLF5 Unknown 21487104
PARP1 Repression 19281796
TSC22D3 Repression 20018851
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
136533 3819 ENSG00000150907
Protein
UniProt ID Q12778
Protein name Forkhead box protein O1 (Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)
Protein function Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress (PubMed:10358076, PubMed:12228231, PubMed:15220471, PubMed:15890677, PubMed:18356527, PubMed:19221179, PubMed:2
PDB 3CO6 , 3CO7 , 3COA , 4LG0 , 5DUI , 6LBI , 6QVW , 6QZR , 6QZS , 8A62 , 8A65
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 160 247 Forkhead domain Domain
PF16675 FOXO_KIX_bdg 423 504 KIX-binding domain of forkhead box O, CR2 Family
PF16676 FOXO-TAD 595 635 Transactivation domain of FOXO protein family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in umbilical endothelial cells (at protein level) (PubMed:19483080). Abundantly expressed in skeletal muscle and ovary, with lower expression in the heart, placenta, lung, liver, pancreas, spleen, testis and small intestine (
Sequence
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSG
KSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVM
STYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNV
LPNQSFPHSVKTTTHSWVSG
Sequence length 655
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acne Vulgaris Associate 23800068, 36585988
Acquired ichthyosis Associate 36303457
Adenocarcinoma Associate 30478420
Adenocarcinoma Mucinous Associate 37569713
Adenomatous Polyposis Coli Associate 22180177
Adrenal Cortex Diseases Associate 28249601
Alzheimer Disease Associate 25364236, 35154571, 36988771
amyloidosis IX Associate 34552661
Amyotrophic Lateral Sclerosis Associate 23469062
Angiofibroma Associate 25674275