Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2308
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box O1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXO1
Synonyms (NCBI Gene) Gene synonyms aliases	FKH1, FKHR, FOXO1A
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q14.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. T

Show/Hide all(490)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001088	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001087	hsa-miR-96-5p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001086	hsa-miR-182-5p	qRT-PCR, Luciferase reporter assay, Western blot	19574223
MIRT001086	hsa-miR-182-5p	Luciferase reporter assay	19574223
MIRT001088	hsa-miR-27a-3p	Luciferase reporter assay	19574223
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay	19574223
MIRT003300	hsa-miR-9-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001087	hsa-miR-96-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003299	hsa-miR-153-3p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003298	hsa-miR-183-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003297	hsa-miR-186-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT003297	hsa-miR-186-5p	Immunohistochemistry, Northern blot, qRT-PCR, Western blot	20028871
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, qRT-PCR, Western blot	22213032
MIRT006733	hsa-miR-223-3p	Flow, Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22569260
MIRT006733	hsa-miR-223-3p	Flow, Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22569260
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay	23509296
MIRT016933	hsa-miR-335-5p	Microarray	18185580
MIRT027447	hsa-miR-98-5p	Microarray	19088304
MIRT051345	hsa-miR-15a-5p	CLASH	23622248
MIRT048219	hsa-miR-196a-5p	CLASH	23622248
MIRT045840	hsa-miR-132-3p	CLASH	23622248
MIRT038575	hsa-miR-106b-3p	CLASH	23622248
MIRT051345	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT051345	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT052909	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT052909	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24862853
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT001087	hsa-miR-96-5p	Microarray	23807165
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT053058	hsa-miR-370-3p	Luciferase reporter assay, qRT-PCR, Western blot	23721824
MIRT053590	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	24374340
MIRT053058	hsa-miR-370-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23029264
MIRT054366	hsa-miR-132-5p	In situ hybridization, Luciferase reporter assay, Next Generation Sequencing (NGS), Western blot	24014289
MIRT001086	hsa-miR-182-5p	Immunohistochemistry, Microarray, qRT-PCR	24865442
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24423924
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT438508	hsa-miR-27b-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT006733	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT001088	hsa-miR-27a-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT438508	hsa-miR-27b-3p	Immunohistochemistry, In situ hybridization, Microarray, qRT-PCR	24746199
MIRT006733	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR, Western blot	24368418
MIRT658095	hsa-miR-4282	HITS-CLIP	23824327
MIRT658094	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT658093	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT658092	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT658091	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT557817	hsa-miR-562	PAR-CLIP	20371350
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT557810	hsa-miR-520h	PAR-CLIP	20371350
MIRT557809	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT557808	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT068628	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT557817	hsa-miR-562	PAR-CLIP	21572407
MIRT557816	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT557815	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT557814	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	21572407
MIRT557812	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT557810	hsa-miR-520h	PAR-CLIP	21572407
MIRT557809	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557808	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT068628	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT537320	hsa-miR-941	PAR-CLIP	22012620
MIRT537318	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT537317	hsa-miR-935	PAR-CLIP	22012620
MIRT537316	hsa-miR-593-5p	PAR-CLIP	22012620
MIRT003298	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT001086	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT537315	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT001087	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT440614	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440614	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT731353	hsa-miR-9-3p	Luciferase reporter assay, Western blot	28397066
MIRT731353	hsa-miR-9-3p	Luciferase reporter assay, Western blot	28397066
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, qRT-PCR, Western blot	26298723
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, qRT-PCR, Western blot	26298723
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	26617698
MIRT438508	hsa-miR-27b-3p	qRT-PCR, Western blot	26452502
MIRT732296	hsa-miR-135b-5p	Flow, Luciferase reporter assay, Western blot	26617737
MIRT732296	hsa-miR-135b-5p	Flow, Luciferase reporter assay, Western blot	26617737
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT001087	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT003300	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	26593208
MIRT734005	hsa-miR-486-5p	Luciferase reporter assay, Western blot	25515961
MIRT734005	hsa-miR-486-5p	Luciferase reporter assay, Western blot	25515961
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blot	27108614
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, Western blot	27556448
MIRT045840	hsa-miR-132-3p	Luciferase reporter assay, Western blot	27556448
MIRT048219	hsa-miR-196a-5p	NCI-H460"	27880728
MIRT756306	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	25909227
MIRT052909	hsa-miR-15b-5p	Flow cytometry, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33519190
MIRT052909	hsa-miR-15b-5p	Flow cytometry, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33519190
MIRT732296	hsa-miR-135b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31416776
MIRT733821	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT734005	hsa-miR-486-5p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	32094299
MIRT735024	hsa-miR-374a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	33296140
MIRT735089	hsa-miR-5188	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31695788
MIRT438508	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR	31526292
MIRT438508	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR	31526292
MIRT736342	hsa-miR-28-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31934134
MIRT736354	hsa-miR-139-5p	Western blotting, qRT-PCR, Flow cytometry	34249000
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR	34036107
MIRT736962	hsa-miR-3127-5p	CLIP-seq, qRT-PCR	32221048
MIRT737137	hsa-miR-15b-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	33519190
MIRT658095	hsa-miR-4282	HITS-CLIP	23824327
MIRT658094	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT658093	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT658092	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT658091	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT557817	hsa-miR-562	PAR-CLIP	20371350
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT557810	hsa-miR-520h	PAR-CLIP	20371350
MIRT557809	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT557808	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT068628	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT557817	hsa-miR-562	PAR-CLIP	21572407
MIRT557816	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT557815	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT557814	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT557813	hsa-miR-4733-5p	PAR-CLIP	21572407
MIRT557812	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT557811	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT557810	hsa-miR-520h	PAR-CLIP	21572407
MIRT557809	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT557808	hsa-miR-324-5p	PAR-CLIP	21572407
MIRT557807	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT068628	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT537320	hsa-miR-941	PAR-CLIP	22012620
MIRT537318	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT537317	hsa-miR-935	PAR-CLIP	22012620
MIRT537316	hsa-miR-593-5p	PAR-CLIP	22012620
MIRT003298	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT001086	hsa-miR-182-5p	PAR-CLIP	22012620
MIRT537315	hsa-miR-1271-5p	PAR-CLIP	22012620
MIRT001087	hsa-miR-96-5p	PAR-CLIP	22012620
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT445379	hsa-miR-8087	PAR-CLIP	22100165
MIRT445380	hsa-miR-3925-5p	PAR-CLIP	22100165
MIRT445378	hsa-miR-3123	PAR-CLIP	22100165
MIRT445377	hsa-miR-520g-5p	PAR-CLIP	22100165
MIRT445376	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445375	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445374	hsa-miR-1253	PAR-CLIP	22100165
MIRT445373	hsa-miR-518d-5p	PAR-CLIP	22100165
MIRT445372	hsa-miR-518e-5p	PAR-CLIP	22100165
MIRT445371	hsa-miR-518f-5p	PAR-CLIP	22100165
MIRT445370	hsa-miR-519a-5p	PAR-CLIP	22100165
MIRT445369	hsa-miR-519b-5p	PAR-CLIP	22100165
MIRT445368	hsa-miR-519c-5p	PAR-CLIP	22100165
MIRT445367	hsa-miR-520c-5p	PAR-CLIP	22100165
MIRT445366	hsa-miR-522-5p	PAR-CLIP	22100165
MIRT445365	hsa-miR-523-5p	PAR-CLIP	22100165
MIRT445364	hsa-miR-526a	PAR-CLIP	22100165
MIRT048219	hsa-miR-196a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, in vivo gain/loss-of-function experiments	35634243
MIRT755765	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Flow cytometry	37272921
MIRT001086	hsa-miR-182-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34950682
MIRT755765	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence	38165707
MIRT003298	hsa-miR-183-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34867446
MIRT756306	hsa-miR-21-5p	qRT-PCR	36071352
MIRT537315	hsa-miR-1271-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence, ChIP-seq, Flow cytometry	36298739
MIRT1002862	hsa-miR-1224-3p	CLIP-seq
MIRT1002863	hsa-miR-1251	CLIP-seq
MIRT1002864	hsa-miR-1256	CLIP-seq
MIRT1002865	hsa-miR-1470	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT1002870	hsa-miR-320e	CLIP-seq
MIRT1002871	hsa-miR-365	CLIP-seq
MIRT1002872	hsa-miR-3667-3p	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT1002874	hsa-miR-3938	CLIP-seq
MIRT1002875	hsa-miR-4257	CLIP-seq
MIRT1002876	hsa-miR-4428	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT1002878	hsa-miR-4436b-5p	CLIP-seq
MIRT1002879	hsa-miR-4527	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT1002881	hsa-miR-4667-3p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT1002883	hsa-miR-4720-5p	CLIP-seq
MIRT1002884	hsa-miR-4755-3p	CLIP-seq
MIRT1002885	hsa-miR-4797-5p	CLIP-seq
MIRT1002886	hsa-miR-4799-3p	CLIP-seq
MIRT1002887	hsa-miR-520d-5p	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT1002889	hsa-miR-524-5p	CLIP-seq
MIRT1002890	hsa-miR-642a	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT1997308	hsa-miR-153	CLIP-seq
MIRT1997309	hsa-miR-15a	CLIP-seq
MIRT1997310	hsa-miR-15b	CLIP-seq
MIRT1997311	hsa-miR-16	CLIP-seq
MIRT1997312	hsa-miR-183	CLIP-seq
MIRT1997313	hsa-miR-1910	CLIP-seq
MIRT1997314	hsa-miR-194	CLIP-seq
MIRT1997315	hsa-miR-195	CLIP-seq
MIRT1997316	hsa-miR-3120-3p	CLIP-seq
MIRT1997317	hsa-miR-3168	CLIP-seq
MIRT1997318	hsa-miR-3689a-5p	CLIP-seq
MIRT1997319	hsa-miR-3689b	CLIP-seq
MIRT1997320	hsa-miR-3689e	CLIP-seq
MIRT1997321	hsa-miR-3689f	CLIP-seq
MIRT1997322	hsa-miR-380	CLIP-seq
MIRT1997323	hsa-miR-3919	CLIP-seq
MIRT1997324	hsa-miR-3973	CLIP-seq
MIRT1997325	hsa-miR-411	CLIP-seq
MIRT1997326	hsa-miR-424	CLIP-seq
MIRT1997327	hsa-miR-4330	CLIP-seq
MIRT1997328	hsa-miR-4495	CLIP-seq
MIRT1997329	hsa-miR-4719	CLIP-seq
MIRT1997330	hsa-miR-490-3p	CLIP-seq
MIRT1997331	hsa-miR-495	CLIP-seq
MIRT1997332	hsa-miR-497	CLIP-seq
MIRT1997333	hsa-miR-513a-3p	CLIP-seq
MIRT1997334	hsa-miR-513b	CLIP-seq
MIRT1997335	hsa-miR-649	CLIP-seq
MIRT1997309	hsa-miR-15a	CLIP-seq
MIRT1997310	hsa-miR-15b	CLIP-seq
MIRT1997311	hsa-miR-16	CLIP-seq
MIRT1997312	hsa-miR-183	CLIP-seq
MIRT1997313	hsa-miR-1910	CLIP-seq
MIRT1997315	hsa-miR-195	CLIP-seq
MIRT2231035	hsa-miR-2053	CLIP-seq
MIRT2231036	hsa-miR-223	CLIP-seq
MIRT1997316	hsa-miR-3120-3p	CLIP-seq
MIRT2231037	hsa-miR-330-3p	CLIP-seq
MIRT2231038	hsa-miR-3691-3p	CLIP-seq
MIRT2231039	hsa-miR-374c	CLIP-seq
MIRT1997326	hsa-miR-424	CLIP-seq
MIRT2231040	hsa-miR-4328	CLIP-seq
MIRT2231041	hsa-miR-4697-3p	CLIP-seq
MIRT1997329	hsa-miR-4719	CLIP-seq
MIRT1997330	hsa-miR-490-3p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT1997332	hsa-miR-497	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2231045	hsa-miR-561	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT1997335	hsa-miR-649	CLIP-seq
MIRT2231048	hsa-miR-655	CLIP-seq
MIRT2388159	hsa-miR-2116	CLIP-seq
MIRT2534906	hsa-miR-1185	CLIP-seq
MIRT2534907	hsa-miR-1282	CLIP-seq
MIRT2534908	hsa-miR-1283	CLIP-seq
MIRT2534909	hsa-miR-186	CLIP-seq
MIRT2534910	hsa-miR-204	CLIP-seq
MIRT2534911	hsa-miR-211	CLIP-seq
MIRT2534912	hsa-miR-3145-5p	CLIP-seq
MIRT2534913	hsa-miR-3148	CLIP-seq
MIRT2534914	hsa-miR-3163	CLIP-seq
MIRT2534915	hsa-miR-3184	CLIP-seq
MIRT2534916	hsa-miR-3189-5p	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT2534917	hsa-miR-335	CLIP-seq
MIRT2534918	hsa-miR-3605-5p	CLIP-seq
MIRT2534919	hsa-miR-3613-3p	CLIP-seq
MIRT2534920	hsa-miR-3616-5p	CLIP-seq
MIRT2534921	hsa-miR-3619-3p	CLIP-seq
MIRT2534922	hsa-miR-3647-5p	CLIP-seq
MIRT2534923	hsa-miR-3658	CLIP-seq
MIRT2534924	hsa-miR-3662	CLIP-seq
MIRT2534925	hsa-miR-3679-5p	CLIP-seq
MIRT2534926	hsa-miR-3681	CLIP-seq
MIRT2534927	hsa-miR-3682-3p	CLIP-seq
MIRT2534928	hsa-miR-3714	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT2534929	hsa-miR-3922-5p	CLIP-seq
MIRT2534930	hsa-miR-423-5p	CLIP-seq
MIRT2534931	hsa-miR-4287	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT2534932	hsa-miR-4469	CLIP-seq
MIRT2534933	hsa-miR-4503	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT2534934	hsa-miR-4655-3p	CLIP-seq
MIRT2534935	hsa-miR-4668-3p	CLIP-seq
MIRT2534936	hsa-miR-4685-3p	CLIP-seq
MIRT2534937	hsa-miR-4687-3p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT2534938	hsa-miR-4700-3p	CLIP-seq
MIRT2534939	hsa-miR-4717-5p	CLIP-seq
MIRT2534940	hsa-miR-4758-3p	CLIP-seq
MIRT2534941	hsa-miR-4760-5p	CLIP-seq
MIRT2534942	hsa-miR-4762-3p	CLIP-seq
MIRT2534943	hsa-miR-4795-5p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2534944	hsa-miR-508-5p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2534945	hsa-miR-514	CLIP-seq
MIRT2534946	hsa-miR-514b-3p	CLIP-seq
MIRT2534947	hsa-miR-520g	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT2534948	hsa-miR-548aa	CLIP-seq
MIRT2534949	hsa-miR-548ae	CLIP-seq
MIRT2534950	hsa-miR-548aj	CLIP-seq
MIRT2534951	hsa-miR-548am	CLIP-seq
MIRT2534952	hsa-miR-548x	CLIP-seq
MIRT2534953	hsa-miR-568	CLIP-seq
MIRT2534954	hsa-miR-573	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2534955	hsa-miR-605	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT2681111	hsa-miR-1183	CLIP-seq
MIRT2534906	hsa-miR-1185	CLIP-seq
MIRT1002862	hsa-miR-1224-3p	CLIP-seq
MIRT2681112	hsa-miR-1278	CLIP-seq
MIRT2681113	hsa-miR-128	CLIP-seq
MIRT2534907	hsa-miR-1282	CLIP-seq
MIRT2681114	hsa-miR-1324	CLIP-seq
MIRT2681115	hsa-miR-145	CLIP-seq
MIRT2534909	hsa-miR-186	CLIP-seq
MIRT2681116	hsa-miR-1915	CLIP-seq
MIRT2534910	hsa-miR-204	CLIP-seq
MIRT2534911	hsa-miR-211	CLIP-seq
MIRT2681117	hsa-miR-27a	CLIP-seq
MIRT2681118	hsa-miR-27b	CLIP-seq
MIRT2534912	hsa-miR-3145-5p	CLIP-seq
MIRT2534913	hsa-miR-3148	CLIP-seq
MIRT2681119	hsa-miR-3160-5p	CLIP-seq
MIRT2534914	hsa-miR-3163	CLIP-seq
MIRT2681120	hsa-miR-3180-5p	CLIP-seq
MIRT2534915	hsa-miR-3184	CLIP-seq
MIRT2534916	hsa-miR-3189-5p	CLIP-seq
MIRT1002866	hsa-miR-320a	CLIP-seq
MIRT1002867	hsa-miR-320b	CLIP-seq
MIRT1002868	hsa-miR-320c	CLIP-seq
MIRT1002869	hsa-miR-320d	CLIP-seq
MIRT2534917	hsa-miR-335	CLIP-seq
MIRT2681121	hsa-miR-338-5p	CLIP-seq
MIRT2681122	hsa-miR-340	CLIP-seq
MIRT2534918	hsa-miR-3605-5p	CLIP-seq
MIRT2534919	hsa-miR-3613-3p	CLIP-seq
MIRT2534920	hsa-miR-3616-5p	CLIP-seq
MIRT2534921	hsa-miR-3619-3p	CLIP-seq
MIRT2534922	hsa-miR-3647-5p	CLIP-seq
MIRT1002871	hsa-miR-365	CLIP-seq
MIRT2681123	hsa-miR-3653	CLIP-seq
MIRT2534923	hsa-miR-3658	CLIP-seq
MIRT2534924	hsa-miR-3662	CLIP-seq
MIRT2534925	hsa-miR-3679-5p	CLIP-seq
MIRT2534926	hsa-miR-3681	CLIP-seq
MIRT2534927	hsa-miR-3682-3p	CLIP-seq
MIRT2681124	hsa-miR-3690	CLIP-seq
MIRT1002873	hsa-miR-371b-5p	CLIP-seq
MIRT2681125	hsa-miR-409-3p	CLIP-seq
MIRT2534930	hsa-miR-423-5p	CLIP-seq
MIRT2534931	hsa-miR-4287	CLIP-seq
MIRT2681126	hsa-miR-4292	CLIP-seq
MIRT2681127	hsa-miR-4308	CLIP-seq
MIRT1002876	hsa-miR-4428	CLIP-seq
MIRT1002877	hsa-miR-4429	CLIP-seq
MIRT2681128	hsa-miR-4446-5p	CLIP-seq
MIRT2534932	hsa-miR-4469	CLIP-seq
MIRT2681129	hsa-miR-4487	CLIP-seq
MIRT2534933	hsa-miR-4503	CLIP-seq
MIRT2681130	hsa-miR-4511	CLIP-seq
MIRT1002879	hsa-miR-4527	CLIP-seq
MIRT1002880	hsa-miR-4639-5p	CLIP-seq
MIRT2534934	hsa-miR-4655-3p	CLIP-seq
MIRT2534935	hsa-miR-4668-3p	CLIP-seq
MIRT2681131	hsa-miR-4680-5p	CLIP-seq
MIRT2534936	hsa-miR-4685-3p	CLIP-seq
MIRT2534937	hsa-miR-4687-3p	CLIP-seq
MIRT2681132	hsa-miR-4693-5p	CLIP-seq
MIRT1002882	hsa-miR-4698	CLIP-seq
MIRT2534938	hsa-miR-4700-3p	CLIP-seq
MIRT2534939	hsa-miR-4717-5p	CLIP-seq
MIRT2681133	hsa-miR-4726-3p	CLIP-seq
MIRT2681134	hsa-miR-4747-5p	CLIP-seq
MIRT1002884	hsa-miR-4755-3p	CLIP-seq
MIRT2681135	hsa-miR-4755-5p	CLIP-seq
MIRT2534940	hsa-miR-4758-3p	CLIP-seq
MIRT2681136	hsa-miR-4759	CLIP-seq
MIRT2534941	hsa-miR-4760-5p	CLIP-seq
MIRT2534942	hsa-miR-4762-3p	CLIP-seq
MIRT2534943	hsa-miR-4795-5p	CLIP-seq
MIRT1002885	hsa-miR-4797-5p	CLIP-seq
MIRT2231042	hsa-miR-494	CLIP-seq
MIRT2231043	hsa-miR-499-3p	CLIP-seq
MIRT2534944	hsa-miR-508-5p	CLIP-seq
MIRT2231044	hsa-miR-5095	CLIP-seq
MIRT2534945	hsa-miR-514	CLIP-seq
MIRT2534946	hsa-miR-514b-3p	CLIP-seq
MIRT2681137	hsa-miR-520a-5p	CLIP-seq
MIRT2534947	hsa-miR-520g	CLIP-seq
MIRT1002888	hsa-miR-522	CLIP-seq
MIRT2681138	hsa-miR-525-5p	CLIP-seq
MIRT2681139	hsa-miR-532-5p	CLIP-seq
MIRT2534948	hsa-miR-548aa	CLIP-seq
MIRT2534949	hsa-miR-548ae	CLIP-seq
MIRT2534950	hsa-miR-548aj	CLIP-seq
MIRT2534951	hsa-miR-548am	CLIP-seq
MIRT2681140	hsa-miR-548b-3p	CLIP-seq
MIRT2534952	hsa-miR-548x	CLIP-seq
MIRT2534953	hsa-miR-568	CLIP-seq
MIRT2534954	hsa-miR-573	CLIP-seq
MIRT2231046	hsa-miR-600	CLIP-seq
MIRT2534955	hsa-miR-605	CLIP-seq
MIRT2231047	hsa-miR-630	CLIP-seq
MIRT2681141	hsa-miR-670	CLIP-seq
MIRT1002891	hsa-miR-888	CLIP-seq
MIRT2681142	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
FOXC1	Unknown	17993506;21837767
KLF5	Unknown	21487104
PARP1	Repression	19281796
TSC22D3	Repression	20018851

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001659	Process	Temperature homeostasis	ISS	22510882
GO:0001678	Process	Cellular glucose homeostasis	ISS	22510882
GO:0003682	Function	Chromatin binding	ISS	22510882
GO:0003700	Function	DNA-binding transcription factor activity	IMP	31063815
GO:0005515	Function	Protein binding	IPI	11237865, 11353774, 15220471, 15692560, 15890677, 17030088, 18235501, 18408765, 18786403, 20543840, 24419615, 24983498, 25241761, 25609649, 28514442, 31063815
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11311120, 12228231, 18680538, 20543840, 31063815
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	11237865, 11311120, 12228231, 20543840, 31063815
GO:0005739	Component	Mitochondrion	ISS	22510882
GO:0005829	Component	Cytosol	ISS	22510882
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006473	Process	Protein acetylation	ISS	22510882
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IMP	31063815
GO:0006974	Process	Cellular response to DNA damage stimulus	ISS
GO:0008013	Function	Beta-catenin binding	IDA	15905404
GO:0008286	Process	Insulin receptor signaling pathway	IBA	21873635
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0009267	Process	Cellular response to starvation	IDA	20543840
GO:0009267	Process	Cellular response to starvation	ISS	22510882
GO:0010508	Process	Positive regulation of autophagy	IMP	20543840
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031018	Process	Endocrine pancreas development	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20543840
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	IDA	19696738
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20543840
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10871843
GO:0043565	Function	Sequence-specific DNA binding	IDA	12228231
GO:0045444	Process	Fat cell differentiation	ISS	22510882
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	20543840
GO:0045892	Process	Negative regulation of transcription, DNA-templated	ISS	22510882
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	7862145, 10871843, 12228231
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10871843, 12228231
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	27577745
GO:0051721	Function	Protein phosphatase 2A binding	ISS
GO:0070166	Process	Enamel mineralization	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070417	Process	Cellular response to cold	ISS	22510882
GO:0070542	Process	Response to fatty acid	ISS
GO:0071455	Process	Cellular response to hyperoxia	IDA	20543840
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0071732	Process	Cellular response to nitric oxide	ISS
GO:0097009	Process	Energy homeostasis	ISS	22510882
GO:1902617	Process	Response to fluoride	IEA
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS

MIM	HGNC	e!Ensembl
136533	3819	ENSG00000150907

Protein

UniProt ID

Q12778

Protein name

Forkhead box protein O1 (Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)

Protein function

Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress (PubMed:10358076, PubMed:12228231, PubMed:15220471, PubMed:15890677, PubMed:18356527, PubMed:19221179, PubMed:2

PDB

3CO6 , 3CO7 , 3COA , 4LG0 , 5DUI , 6LBI , 6QVW , 6QZR , 6QZS , 8A62 , 8A65

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	160 → 247	Forkhead domain	Domain
PF16675	FOXO_KIX_bdg	423 → 504	KIX-binding domain of forkhead box O, CR2	Family
PF16676	FOXO-TAD	595 → 635	Transactivation domain of FOXO protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in umbilical endothelial cells (at protein level) (PubMed:19483080). Abundantly expressed in skeletal muscle and ovary, with lower expression in the heart, placenta, lung, liver, pancreas, spleen, testis and small intestine (

Sequence

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Sequence length

655

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Eczema	Eczema	GWAS
Uterine Fibroids	Uterine Fibroids	GWAS
Keratoconus	Keratoconus	GWAS
Hypothyroidism	Hypothyroidism	GWAS
Eosinophilia	Eosinophilia	GWAS
Alzheimer disease	Alzheimer disease	GWAS

Show/Hide Text Mining Associations (231)

Disease Name	Relationship Type	References
Associations from Text Mining
Acne Vulgaris	Associate	23800068, 36585988
Acquired ichthyosis	Associate	36303457
Adenocarcinoma	Associate	30478420
Adenocarcinoma Mucinous	Associate	37569713
Adenomatous Polyposis Coli	Associate	22180177
Adrenal Cortex Diseases	Associate	28249601
Alzheimer Disease	Associate	25364236, 35154571, 36988771
amyloidosis IX	Associate	34552661
Amyotrophic Lateral Sclerosis	Associate	23469062
Angiofibroma	Associate	25674275
Aortic Aneurysm Abdominal	Associate	29439675
Arm Injuries	Associate	34389744
Arthritis	Associate	37493406
Arthritis Rheumatoid	Associate	17873969, 22736089, 32879318, 38029456
Arthritis Rheumatoid	Stimulate	29129636
Arthritis Rheumatoid	Inhibit	37506143
Astrocytoma	Associate	23874926
Ataxia Telangiectasia	Associate	35879366
Atherosclerosis	Associate	25273948
Atrophy	Associate	16916907, 21900687, 24704539, 27526027, 35458760
Autistic Disorder	Associate	29423132
Autoimmune Diseases	Associate	30678091
Bone Marrow Diseases	Associate	29214757
Brain Neoplasms	Associate	17442120
Breast Neoplasms	Associate	14527951, 19574223, 20551062, 22272226, 25017439, 26919657, 28096479, 29796115, 32207860, 33519190, 35637961, 35800988, 36539739, 36602390, 36901916, 37640964 View all (1 more)
Burkitt Lymphoma	Associate	28465297, 31300419, 35079069
Calcification of Joints and Arteries	Associate	32375544
Calcinosis	Associate	32375544
Calcinosis Cutis	Associate	22089931
Carcinogenesis	Associate	15184910, 27268017, 28099936, 28249601, 30001537, 32236623, 32716350, 33627785
Carcinoma	Inhibit	25674275, 28887603
Carcinoma	Associate	29695401
Carcinoma Basal Cell	Associate	23435205
Carcinoma Hepatocellular	Associate	23255113, 25053419, 25472505, 25739100, 30009772, 30092792, 35761036, 35805200, 36359865, 37099251, 39383136
Carcinoma Hepatocellular	Inhibit	29879025
Carcinoma Intraductal Noninfiltrating	Stimulate	16341149
Carcinoma Non Small Cell Lung	Associate	24705809, 25311537, 26036758, 26303949, 26548866, 30690883, 32716350, 33772142, 35126623, 36003920
Carcinoma Non Small Cell Lung	Inhibit	30001537
Carcinoma Ovarian Epithelial	Associate	31823759, 32224523
Carcinoma Pancreatic Ductal	Associate	25623117
Carcinoma Pancreatic Ductal	Inhibit	30227407
Carcinoma Renal Cell	Associate	25202916
Cardiomyopathy Dilated	Associate	37967839
Cardiovascular Diseases	Associate	30423812
Carotid Artery Diseases	Associate	25273948
Carotid Artery Thrombosis	Associate	31450612
Carotid Stenosis	Associate	21075101
Cartilage Diseases	Associate	37493406
Cataract Age Related Nuclear	Associate	36987450
Cerebrovascular Disorders	Stimulate	36577299
Cholangiocarcinoma	Associate	29466794, 35609322, 36848245
Chromosome 15q trisomy	Associate	29423132
Cognition Disorders	Associate	24895270
Colonic Neoplasms	Associate	22180177
Colorectal Neoplasms	Inhibit	30535125
Colorectal Neoplasms	Associate	32221048, 36303457, 40314832
Coronary Disease	Associate	24489705
COVID 19	Associate	33301474
Critical Illness	Associate	21483870
Cystic Fibrosis	Inhibit	30964354
Desmoplastic Small Round Cell Tumor	Associate	24517889
Diabetes Complications	Associate	35154571
Diabetes Gestational	Associate	30558244, 31261027
Diabetes Mellitus	Associate	25674226, 31864032, 36577299, 36978091, 37335063
Diabetes Mellitus Type 1	Associate	36303457, 39464889
Diabetes Mellitus Type 2	Associate	26337673, 26386696, 28049237, 28733598, 28860538
Diabetic Nephropathies	Associate	28860538, 30987438, 36626516
Drug Related Side Effects and Adverse Reactions	Associate	21418583, 26585955, 30841958
Embolism Fat	Associate	33449950
Endometrial Neoplasms	Associate	18096667, 19041124, 34233525, 35717540, 36047377
Endometrial Neoplasms	Inhibit	20028871
Epstein Barr Virus Infections	Inhibit	16943287
Esophageal Neoplasms	Associate	19360286
Esophageal Squamous Cell Carcinoma	Associate	28188753
Familial cylindromatosis	Associate	30478420
Fatty Liver	Associate	33449950
Fatty Liver Alcoholic	Associate	30009772
Fetal Growth Retardation	Associate	25202916
Fibrosarcoma	Associate	24517889
Glaucoma	Associate	26396484
Glioblastoma	Associate	23874926, 24771221, 25566967, 26449824, 36602390
Glioma	Associate	23874926, 26449824, 27448972, 30015885, 30024610, 30841958, 31098771, 32902145, 36602390
Glycosuria Renal	Associate	36978091
Granulosa Cell Tumor	Associate	33639972
Graves Ophthalmopathy	Inhibit	26213859
Head and Neck Neoplasms	Associate	27688110
Heart Failure	Stimulate	24704539
Heart Septal Defects	Associate	30423812
Heart Septal Defects Ventricular	Associate	30423812
Hemangioma	Associate	33318580
Hemangiosarcoma	Associate	30801864
Hepatic Encephalopathy	Stimulate	36424620
Hepatitis C	Associate	21697492, 24478438
Hereditary Breast and Ovarian Cancer Syndrome	Associate	32332845
Hereditary leiomyomatosis and renal cell cancer	Associate	27166193
HIV Infections	Associate	34249000
Hodgkin Disease	Inhibit	22343918, 24977668
Hodgkin Disease	Associate	25232062, 27166193, 29439954
Huntington Disease	Stimulate	28973411
Huntington Disease	Associate	35154571
Hyperglycemia	Inhibit	31828164
Hyperglycemia	Associate	36577299, 36626516
Hyperinsulinism	Associate	28135285
Hypertension	Associate	25273948, 32888289
Hypothyroidism Congenital Nongoitrous 2	Associate	38412094
Hypoxia	Inhibit	20068066, 29843131
Hypoxia	Associate	37713813
Idiopathic Pulmonary Fibrosis	Inhibit	36578501
Idiopathic Pulmonary Fibrosis	Associate	38252663
Immunoglobulin G4 Related Disease	Associate	15184910, 19442434
Immunoglobulin G4 Related Disease	Stimulate	20068066
Infectious Mononucleosis	Stimulate	36154925
Infertility	Associate	36303457
Inflammation	Associate	28542447, 30148860, 30790508, 32581510, 36626516, 37506143
Inflammation	Inhibit	32973162
Insulin Resistance	Associate	26386696, 29414761, 31547433, 34034759, 34946711, 35154571, 37409718, 38102588
Intervertebral Disc Degeneration	Associate	30790508, 35094651, 35840955, 40510349
Keratoconus	Associate	26040312, 28207827, 38267912
Kidney Neoplasms	Associate	37528416
Laryngeal Neoplasms	Associate	25008564
Leiomyoma	Associate	19772960, 31288815
Leukemia	Associate	21418583, 40420801
Leukemia Biphenotypic Acute	Associate	36670235
Leukemia Lymphocytic Chronic B Cell	Associate	33786575
Leukemia Lymphoma Adult T Cell	Associate	28189723
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	37100862, 40503228, 9753053
Leukemia Myeloid	Associate	36282572
Leukemia Myeloid Acute	Associate	24923295, 35941390
Liver Cirrhosis	Associate	29879025, 37464780
Lower Extremity Deformities Congenital	Associate	20538844
Lung Diseases	Associate	32457348
Lung Neoplasms	Associate	23888319, 26572153, 30001537
Lupus Erythematosus Systemic	Associate	17873969, 27816669
Lymphatic Metastasis	Associate	21505104
Lymphoma	Associate	31300419
Lymphoma B Cell	Inhibit	24977668
Lymphoma B Cell	Associate	35079069
Lymphoma Follicular	Associate	30520026, 33327711, 35079069, 36994552
Lymphoma Large B Cell Diffuse	Associate	22966017, 23460611, 25909227, 26314988, 26585955, 35045798, 35079069, 40589747
Lymphoma Mantle Cell	Associate	36282572
Lymphoma Non Hodgkin	Associate	35079069
Lymphoma T Cell	Associate	32373978
Lymphoma T Cell Peripheral	Associate	30520026
Malignant Teratocarcinosarcoma	Associate	26355893
Melanoma	Associate	26261511, 36303457
Metabolic Syndrome	Associate	23025577
Mitochondrial Diseases	Associate	29466794, 35342363
Mitochondrial Diseases	Stimulate	31261027
Mohr Tranebjaerg syndrome	Associate	32016462
Mouth Diseases	Inhibit	30227407
Mouth Neoplasms	Associate	28099936
Multiple Sclerosis	Associate	27312110
Muscular Atrophy	Associate	18240972, 23469062
Muscular Disorders Atrophic	Associate	20639440, 27526027, 36094432
Myelodysplastic Syndromes	Associate	32772642, 36290822, 40420801
Myoepithelioma	Associate	33506328
Myostatin related muscle hypertrophy	Associate	16916907
Myotoxicity	Associate	40055879
Nasopharyngeal Carcinoma	Associate	18570662, 35562411, 36061358
Neoplasm Invasiveness	Associate	40314832
Neoplasm Metastasis	Associate	22533991, 23888319, 24705809, 24771221, 26303949, 32224523, 34670517, 35126623, 35562411, 37099251, 37524903
Neoplasm Metastasis	Inhibit	25017439
Neoplasm Metastasis	Stimulate	37120633
Neoplasms	Inhibit	12150827, 18570662, 19574223, 20028871, 21969818, 22343918, 23029264, 23748164, 23867395, 23874926, 24167614, 25311537, 25806826, 26524723, 28483946 View all (10 more)
Neoplasms	Associate	12351634, 15184910, 16435141, 17491598, 19124971, 20420826, 20663909, 21655267, 21762516, 21873240, 21980390, 22180177, 24149177, 24427371, 25330112 View all (31 more)
Neoplasms	Stimulate	19543511
Neoplasms Adipose Tissue	Associate	22797373
Neoplasms Muscle Tissue	Inhibit	25674275
Neuroblastoma	Associate	16133873, 21354306, 31696486, 35163437
Neurodegenerative Diseases	Associate	19714246
Neuroectodermal Tumors Primitive	Associate	17442120
Neuroma Acoustic	Associate	30953268
Non alcoholic Fatty Liver Disease	Associate	31864032
Obesity	Inhibit	22797373
Obesity	Associate	23025577, 26337673, 26386696, 28049237, 31547433, 32555314
Osteoarthritis	Associate	32281255
Osteolysis	Associate	29338713
Osteoporosis	Associate	32404197
Osteosarcoma	Associate	23867395, 38343056
Ovarian Diseases	Associate	33694202
Ovarian Neoplasms	Associate	18319717, 23574718, 24870723, 25483711, 30614794, 32016462, 32192517, 37120633, 38143770
Pancreatic Neoplasms	Associate	32181755
Periodontal Diseases	Associate	37175429
Periodontitis	Associate	27512949, 36299623
Peripheral Arterial Disease	Associate	32375544
Plaque Atherosclerotic	Associate	21075101
Pneumonia Lipid	Associate	33449950
Polycystic Ovary Syndrome	Inhibit	30964354, 33287836
Pre Eclampsia	Associate	25202916
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27160160, 32964916
Primary Ovarian Insufficiency	Associate	16979636
Prostatic Neoplasms	Associate	12351634, 12482965, 14726521, 15692560, 17597184, 19075016, 19377286, 19574223, 20623629, 21505104, 21969818, 23029264, 23389878, 23951320, 24260486 View all (6 more)
Prostatitis	Associate	27164937
Pulmonary Arterial Hypertension	Associate	31437238
Pulmonary Disease Chronic Obstructive	Stimulate	18415806
Pulmonary Disease Chronic Obstructive	Associate	27526027, 29138552, 32982206
Recurrence	Associate	32224523
Renal Insufficiency	Associate	28135285
Renal Insufficiency Chronic	Associate	31257514
Respiratory Tract Diseases	Associate	37925496
Retinal Diseases	Associate	36577299
Rhabdomyosarcoma	Associate	11556833, 20068066, 20663909, 22089931, 22447499, 23435416, 25768946, 25806826, 26226845, 26473193, 27799565, 28521080, 28615069, 29461635, 29898687 View all (22 more)
Rhabdomyosarcoma Alveolar	Associate	10393185, 10666368, 12239174, 15184910, 15838707, 16645206, 16849537, 18973919, 19039198, 19442434, 19953635, 19995556, 20663909, 21128778, 21321994 View all (38 more)
Rhabdomyosarcoma Alveolar	Stimulate	28380437
Rhabdomyosarcoma Embryonal	Associate	10666368, 15184910, 29214757, 39379998
Sarcoma	Associate	25300797, 29580035, 36928336, 7887445
Sarcoma Ewing	Associate	20933505, 24517889
Sarcoma Kaposi	Associate	30404794
Sjogren's Syndrome	Associate	34948236
Squamous Cell Carcinoma of Head and Neck	Associate	23827155, 31583913
Stomach Neoplasms	Associate	17491598, 19697059, 21696576, 24374340, 27268017, 28343375, 32474511, 36475746
Supratentorial Neoplasms	Associate	30514397
Sveinsson Chorioretinal Atrophy	Inhibit	24865442
Telangiectasia Hereditary Hemorrhagic	Associate	37689549
Thrombosis	Associate	31450612
Thyroid Cancer Papillary	Associate	26617698
Thyroid Carcinoma Anaplastic	Associate	30242671
Tongue Neoplasms	Associate	25749387
Triple Negative Breast Neoplasms	Associate	38104484
Trisomy 13 Syndrome	Associate	30423812
Urinary Bladder Neoplasms	Associate	19543511, 25888950, 31714185, 31769229, 32678492, 33283616, 36293387, 36430344, 38073044
Uterine Cervical Dysplasia	Associate	32993576
Uterine Cervical Neoplasms	Associate	24423924, 26214423, 26617737, 29762826, 31302815
Uterine Diseases	Associate	26524723, 28135285
Varicose Ulcer	Associate	32867785
Vascular Calcification	Associate	32375544
Venous Malformations Multiple Cutaneous and Mucosal	Associate	32867785
Venous Thrombosis	Associate	32156832
Virus Diseases	Associate	37967839
Weight Loss	Associate	27897403
X Linked Combined Immunodeficiency Diseases	Associate	35941390, 9753053

FOXO1 (forkhead box O1)