Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2209
Gene name Gene Name - the full gene name approved by the HGNC.	Fc gamma receptor Ia
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FCGR1A
Synonyms (NCBI Gene) Gene synonyms aliases	CD64, CD64A, FCG1, FCGR1, FCRI, FcgammaRI, IGFR1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq, Jul 2008]

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT993836	hsa-miR-3120-5p	CLIP-seq
MIRT993837	hsa-miR-4311	CLIP-seq
MIRT993838	hsa-miR-4652-3p	CLIP-seq
MIRT993839	hsa-miR-4711-3p	CLIP-seq
MIRT993840	hsa-miR-4753-3p	CLIP-seq
MIRT993841	hsa-miR-4768-5p	CLIP-seq
MIRT993842	hsa-miR-593	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SPI1	Unknown	10820245;14734612
STAT1	Unknown	14734612

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	18322202, 22003208, 25925696, 29143175, 32296183
GO:0005886	Component	Plasma membrane	IDA	18322202
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0006911	Process	Phagocytosis, engulfment	TAS	10879688
GO:0006955	Process	Immune response	TAS	10879688
GO:0007165	Process	Signal transduction	TAS	10879688
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0019864	Function	IgG binding	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0050776	Process	Regulation of immune response	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IMP	10556798

MIM	HGNC	e!Ensembl
146760	3613	ENSG00000150337

Protein

UniProt ID

P12314

Protein name

High affinity immunoglobulin gamma Fc receptor I (IgG Fc receptor I) (Fc-gamma RI) (FcRI) (Fc-gamma RIA) (FcgammaRIa) (CD antigen CD64)

Protein function

High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. Mediates IgG effector functions on monocytes triggering antibody-dependent cellular cytotoxicity (ADCC) of virus-infected

PDB

3RJD , 4W4O , 4X4M , 4ZNE , 8DIN , 8DIR , 8DJ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	23 → 87		Domain
PF13895	Ig_2	104 → 185	Immunoglobulin domain	Domain
PF00047	ig	195 → 275	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Monocyte/macrophage specific.

Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT

Sequence length

374

Interactions

View interactions

FCGR1A (Fc gamma receptor Ia)