Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	355
Gene name	Fas cell surface death receptor
Gene symbol	FAS
Synonyms (NCBI Gene)	ALPS1AAPO-1APT1CD95FAS1FASTMTNFRSF6
Chromosome	10
Chromosome location	10q23.31
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogen

Show/Hide all (41)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28929498	A>T	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant, non coding transcript variant
rs56006128	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance, not-provided	Intron variant, coding sequence variant, missense variant, non coding transcript variant
rs121913076	A>C	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913077	C>T	Pathogenic	Non coding transcript variant, stop gained, 3 prime UTR variant, coding sequence variant
rs121913078	C>T	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913079	A>G	Pathogenic, uncertain-significance	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913080	G>C	Pathogenic, likely-pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913081	C>T	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913082	A>G	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913083	A>G	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913084	T>C	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913085	G>C	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913086	G>T	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs267607122	T>A,C	Pathogenic	Splice donor variant, intron variant
rs483352683	T>A,C	Likely-pathogenic, uncertain-significance	Coding sequence variant, 3 prime UTR variant, non coding transcript variant, missense variant
rs606231361	G>-	Pathogenic	Coding sequence variant, intron variant, frameshift variant, non coding transcript variant
rs606231362	->T	Pathogenic	Intron variant, splice donor variant
rs606231363	A>C	Pathogenic	Intron variant, splice acceptor variant
rs606231364	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs606231365	->AAAATTCAAACTTCAGAAAT	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, 3 prime UTR variant
rs606231366	->T	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, 3 prime UTR variant
rs778993919	C>A,T	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant, 3 prime UTR variant, synonymous variant
rs886039359	G>A	Pathogenic	Intron variant, splice donor variant
rs886039524	AT>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant, 3 prime UTR variant
rs1085307626	G>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, intron variant, coding sequence variant
rs1554851356	C>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1554851718	T>G	Likely-pathogenic	Non coding transcript variant, intron variant, missense variant, coding sequence variant
rs1554852090	A>-	Likely-pathogenic	Intron variant, frameshift variant, non coding transcript variant, stop gained, coding sequence variant
rs1554852244	->CATG	Pathogenic	Non coding transcript variant, frameshift variant, 3 prime UTR variant, coding sequence variant
rs1564686301	T>A	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1564691414	A>G	Likely-pathogenic	Intron variant, splice acceptor variant
rs1564692984	T>-,TT	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1564696849	G>A,T	Pathogenic, pathogenic-likely-pathogenic	Intron variant, splice donor variant
rs1564699214	A>-	Pathogenic	Non coding transcript variant, frameshift variant, 3 prime UTR variant, coding sequence variant
rs1589465172	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1589465256	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1589478691	G>-	Pathogenic	Frameshift variant, coding sequence variant, intron variant, non coding transcript variant
rs1589485636	->TGAAAT	Pathogenic	Intron variant, splice donor variant
rs1589488463	G>A	Pathogenic	Splice acceptor variant, intron variant
rs1589488494	AG>-	Pathogenic	Frameshift variant, coding sequence variant, intron variant, non coding transcript variant
rs1589488640	G>A	Pathogenic	Intron variant, splice donor variant

358

Show/Hide all (358)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	20656888
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT016252	hsa-miR-504-5p	qRT-PCR	20542001
MIRT027598	hsa-miR-98-5p	Microarray	19088304
MIRT002421	hsa-miR-21-5p	Microarray	20048743
MIRT053338	hsa-miR-196b-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22353710
MIRT053338	hsa-miR-196b-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22353710
MIRT053381	hsa-miR-23a-3p	FlowLuciferase reporter assayMicroarrayWestern blot	23804233
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT127441	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT127442	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT731620	hsa-miR-133b	Luciferase reporter assay	26919791
MIRT731620	hsa-miR-133b	Luciferase reporter assay	26919791
MIRT006331	hsa-miR-106a-5p	FlowImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	27142596
MIRT006331	hsa-miR-106a-5p	FlowImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	27142596
MIRT053338	hsa-miR-196b-5p	Luciferase reporter assayqRT-PCRWestern blot	25605245
MIRT053338	hsa-miR-196b-5p	Luciferase reporter assayqRT-PCRWestern blot	25605245
MIRT005581	hsa-miR-146a-5p	ImmunofluorescenceqRT-PCR	32210951
MIRT053338	hsa-miR-196b-5p	Western blottingImmunohistochemistry (IHC)qRT-PCRFlow cytometryELISA	32963220
MIRT735853	hsa-miR-141-3p	qRT-PCRELISA	32691634
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT989478	hsa-miR-23a	CLIP-seq
MIRT989479	hsa-miR-23b	CLIP-seq
MIRT989480	hsa-miR-23c	CLIP-seq
MIRT989481	hsa-miR-3170	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT989484	hsa-miR-3691-5p	CLIP-seq
MIRT989485	hsa-miR-374c	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT989487	hsa-miR-4282	CLIP-seq
MIRT989488	hsa-miR-4293	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT989490	hsa-miR-4481	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT989492	hsa-miR-4745-5p	CLIP-seq
MIRT989493	hsa-miR-4752	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT989495	hsa-miR-596	CLIP-seq
MIRT989496	hsa-miR-655	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530912	hsa-miR-103b	CLIP-seq
MIRT2530913	hsa-miR-1206	CLIP-seq
MIRT2530914	hsa-miR-1225-5p	CLIP-seq
MIRT2530915	hsa-miR-1251	CLIP-seq
MIRT2530916	hsa-miR-1275	CLIP-seq
MIRT2530917	hsa-miR-1283	CLIP-seq
MIRT2530918	hsa-miR-1295	CLIP-seq
MIRT2530919	hsa-miR-129-5p	CLIP-seq
MIRT2530920	hsa-miR-1302	CLIP-seq
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT2530921	hsa-miR-1305	CLIP-seq
MIRT2530922	hsa-miR-153	CLIP-seq
MIRT2530923	hsa-miR-181a	CLIP-seq
MIRT2530924	hsa-miR-181b	CLIP-seq
MIRT2530925	hsa-miR-181c	CLIP-seq
MIRT2530926	hsa-miR-181d	CLIP-seq
MIRT2530927	hsa-miR-185	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT2530928	hsa-miR-1976	CLIP-seq
MIRT2530929	hsa-miR-200b	CLIP-seq
MIRT2530930	hsa-miR-200c	CLIP-seq
MIRT2530931	hsa-miR-216b	CLIP-seq
MIRT2530932	hsa-miR-217	CLIP-seq
MIRT2530933	hsa-miR-2278	CLIP-seq
MIRT2530934	hsa-miR-28-3p	CLIP-seq
MIRT2530935	hsa-miR-29a	CLIP-seq
MIRT2530936	hsa-miR-29b	CLIP-seq
MIRT2530937	hsa-miR-29c	CLIP-seq
MIRT2530938	hsa-miR-302f	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2530939	hsa-miR-3140-3p	CLIP-seq
MIRT2530940	hsa-miR-3145-3p	CLIP-seq
MIRT2530941	hsa-miR-3148	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2530942	hsa-miR-325	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT2530943	hsa-miR-342-5p	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2530944	hsa-miR-3653	CLIP-seq
MIRT2530945	hsa-miR-3658	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT2530946	hsa-miR-3663-3p	CLIP-seq
MIRT2530947	hsa-miR-3675-3p	CLIP-seq
MIRT2530948	hsa-miR-3677-5p	CLIP-seq
MIRT2530949	hsa-miR-3688-5p	CLIP-seq
MIRT2530950	hsa-miR-3689a-5p	CLIP-seq
MIRT2530951	hsa-miR-3689b	CLIP-seq
MIRT2530952	hsa-miR-3689e	CLIP-seq
MIRT2530953	hsa-miR-3689f	CLIP-seq
MIRT2530954	hsa-miR-370	CLIP-seq
MIRT2530955	hsa-miR-371b-5p	CLIP-seq
MIRT2530956	hsa-miR-376a	CLIP-seq
MIRT2530957	hsa-miR-376b	CLIP-seq
MIRT2530958	hsa-miR-3920	CLIP-seq
MIRT2530959	hsa-miR-3921	CLIP-seq
MIRT2530960	hsa-miR-3974	CLIP-seq
MIRT2530961	hsa-miR-4251	CLIP-seq
MIRT2530962	hsa-miR-4252	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT2530963	hsa-miR-4260	CLIP-seq
MIRT2530964	hsa-miR-4262	CLIP-seq
MIRT2530965	hsa-miR-429	CLIP-seq
MIRT2530966	hsa-miR-4291	CLIP-seq
MIRT2530967	hsa-miR-4298	CLIP-seq
MIRT2530968	hsa-miR-4306	CLIP-seq
MIRT2530969	hsa-miR-4324	CLIP-seq
MIRT2530970	hsa-miR-4329	CLIP-seq
MIRT2530971	hsa-miR-433	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT2530972	hsa-miR-4426	CLIP-seq
MIRT2530973	hsa-miR-4446-5p	CLIP-seq
MIRT2530974	hsa-miR-4447	CLIP-seq
MIRT2530975	hsa-miR-4470	CLIP-seq
MIRT2530976	hsa-miR-4472	CLIP-seq
MIRT2530977	hsa-miR-4477a	CLIP-seq
MIRT2530978	hsa-miR-448	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530979	hsa-miR-4517	CLIP-seq
MIRT2530980	hsa-miR-4525	CLIP-seq
MIRT2530981	hsa-miR-4644	CLIP-seq
MIRT2530982	hsa-miR-4647	CLIP-seq
MIRT2530983	hsa-miR-4651	CLIP-seq
MIRT2530984	hsa-miR-4653-5p	CLIP-seq
MIRT2530985	hsa-miR-4659a-3p	CLIP-seq
MIRT2530986	hsa-miR-4659b-3p	CLIP-seq
MIRT2530987	hsa-miR-4662b	CLIP-seq
MIRT2530988	hsa-miR-4664-5p	CLIP-seq
MIRT2530989	hsa-miR-4665-5p	CLIP-seq
MIRT2530990	hsa-miR-4668-3p	CLIP-seq
MIRT2530991	hsa-miR-4668-5p	CLIP-seq
MIRT2530992	hsa-miR-4670-3p	CLIP-seq
MIRT2530993	hsa-miR-4680-3p	CLIP-seq
MIRT2530994	hsa-miR-4694-3p	CLIP-seq
MIRT2530995	hsa-miR-4698	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT2530996	hsa-miR-4716-5p	CLIP-seq
MIRT2530997	hsa-miR-4717-5p	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT2530998	hsa-miR-4723-5p	CLIP-seq
MIRT2530999	hsa-miR-4763-5p	CLIP-seq
MIRT2531000	hsa-miR-4768-5p	CLIP-seq
MIRT2531001	hsa-miR-4778-3p	CLIP-seq
MIRT2531002	hsa-miR-4781-3p	CLIP-seq
MIRT2531003	hsa-miR-4787-5p	CLIP-seq
MIRT2531004	hsa-miR-4793-5p	CLIP-seq
MIRT2531005	hsa-miR-4796-3p	CLIP-seq
MIRT2531006	hsa-miR-483-3p	CLIP-seq
MIRT2531007	hsa-miR-485-3p	CLIP-seq
MIRT2531008	hsa-miR-510	CLIP-seq
MIRT2531009	hsa-miR-512-5p	CLIP-seq
MIRT2531010	hsa-miR-518a-5p	CLIP-seq
MIRT2531011	hsa-miR-520g	CLIP-seq
MIRT2531012	hsa-miR-520h	CLIP-seq
MIRT2531013	hsa-miR-527	CLIP-seq
MIRT2531014	hsa-miR-539	CLIP-seq
MIRT2531015	hsa-miR-545	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT2531016	hsa-miR-548c-3p	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT2531017	hsa-miR-548p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT2531018	hsa-miR-587	CLIP-seq
MIRT2531019	hsa-miR-607	CLIP-seq
MIRT2531020	hsa-miR-608	CLIP-seq
MIRT2531021	hsa-miR-625	CLIP-seq
MIRT2531022	hsa-miR-628-3p	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT2531023	hsa-miR-760	CLIP-seq
MIRT2531024	hsa-miR-767-3p	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT2531025	hsa-miR-942	CLIP-seq
MIRT2530912	hsa-miR-103b	CLIP-seq
MIRT2530913	hsa-miR-1206	CLIP-seq
MIRT2530914	hsa-miR-1225-5p	CLIP-seq
MIRT2530915	hsa-miR-1251	CLIP-seq
MIRT2530916	hsa-miR-1275	CLIP-seq
MIRT2530917	hsa-miR-1283	CLIP-seq
MIRT2530918	hsa-miR-1295	CLIP-seq
MIRT2530919	hsa-miR-129-5p	CLIP-seq
MIRT2530920	hsa-miR-1302	CLIP-seq
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT2530921	hsa-miR-1305	CLIP-seq
MIRT2530922	hsa-miR-153	CLIP-seq
MIRT2530923	hsa-miR-181a	CLIP-seq
MIRT2530924	hsa-miR-181b	CLIP-seq
MIRT2530925	hsa-miR-181c	CLIP-seq
MIRT2530926	hsa-miR-181d	CLIP-seq
MIRT2680780	hsa-miR-1827	CLIP-seq
MIRT2530927	hsa-miR-185	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT2530928	hsa-miR-1976	CLIP-seq
MIRT2530929	hsa-miR-200b	CLIP-seq
MIRT2530930	hsa-miR-200c	CLIP-seq
MIRT2530931	hsa-miR-216b	CLIP-seq
MIRT2530932	hsa-miR-217	CLIP-seq
MIRT2530933	hsa-miR-2278	CLIP-seq
MIRT2530934	hsa-miR-28-3p	CLIP-seq
MIRT2530935	hsa-miR-29a	CLIP-seq
MIRT2530936	hsa-miR-29b	CLIP-seq
MIRT2530937	hsa-miR-29c	CLIP-seq
MIRT2530938	hsa-miR-302f	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2530939	hsa-miR-3140-3p	CLIP-seq
MIRT2530940	hsa-miR-3145-3p	CLIP-seq
MIRT2530941	hsa-miR-3148	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2680781	hsa-miR-3189-3p	CLIP-seq
MIRT2530942	hsa-miR-325	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT2530943	hsa-miR-342-5p	CLIP-seq
MIRT2680782	hsa-miR-3612	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT2680783	hsa-miR-362-5p	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2530944	hsa-miR-3653	CLIP-seq
MIRT2530945	hsa-miR-3658	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT2530946	hsa-miR-3663-3p	CLIP-seq
MIRT2530947	hsa-miR-3675-3p	CLIP-seq
MIRT2530948	hsa-miR-3677-5p	CLIP-seq
MIRT2530949	hsa-miR-3688-5p	CLIP-seq
MIRT2530950	hsa-miR-3689a-5p	CLIP-seq
MIRT2530951	hsa-miR-3689b	CLIP-seq
MIRT2530952	hsa-miR-3689e	CLIP-seq
MIRT2530953	hsa-miR-3689f	CLIP-seq
MIRT2530954	hsa-miR-370	CLIP-seq
MIRT2530955	hsa-miR-371b-5p	CLIP-seq
MIRT2530958	hsa-miR-3920	CLIP-seq
MIRT2530959	hsa-miR-3921	CLIP-seq
MIRT2530960	hsa-miR-3974	CLIP-seq
MIRT2530961	hsa-miR-4251	CLIP-seq
MIRT2530962	hsa-miR-4252	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT2530963	hsa-miR-4260	CLIP-seq
MIRT2530964	hsa-miR-4262	CLIP-seq
MIRT2530965	hsa-miR-429	CLIP-seq
MIRT2530966	hsa-miR-4291	CLIP-seq
MIRT2530967	hsa-miR-4298	CLIP-seq
MIRT2530968	hsa-miR-4306	CLIP-seq
MIRT2680784	hsa-miR-432	CLIP-seq
MIRT2530969	hsa-miR-4324	CLIP-seq
MIRT2530970	hsa-miR-4329	CLIP-seq
MIRT2530971	hsa-miR-433	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT2530972	hsa-miR-4426	CLIP-seq
MIRT2680785	hsa-miR-4443	CLIP-seq
MIRT2530973	hsa-miR-4446-5p	CLIP-seq
MIRT2530974	hsa-miR-4447	CLIP-seq
MIRT2530975	hsa-miR-4470	CLIP-seq
MIRT2530976	hsa-miR-4472	CLIP-seq
MIRT2530977	hsa-miR-4477a	CLIP-seq
MIRT2530978	hsa-miR-448	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530979	hsa-miR-4517	CLIP-seq
MIRT2530980	hsa-miR-4525	CLIP-seq
MIRT2530981	hsa-miR-4644	CLIP-seq
MIRT2530982	hsa-miR-4647	CLIP-seq
MIRT2530983	hsa-miR-4651	CLIP-seq
MIRT2530984	hsa-miR-4653-5p	CLIP-seq
MIRT2530985	hsa-miR-4659a-3p	CLIP-seq
MIRT2530986	hsa-miR-4659b-3p	CLIP-seq
MIRT2530987	hsa-miR-4662b	CLIP-seq
MIRT2530988	hsa-miR-4664-5p	CLIP-seq
MIRT2530989	hsa-miR-4665-5p	CLIP-seq
MIRT2530990	hsa-miR-4668-3p	CLIP-seq
MIRT2530991	hsa-miR-4668-5p	CLIP-seq
MIRT2530992	hsa-miR-4670-3p	CLIP-seq
MIRT2530993	hsa-miR-4680-3p	CLIP-seq
MIRT2530994	hsa-miR-4694-3p	CLIP-seq
MIRT2530995	hsa-miR-4698	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT2530996	hsa-miR-4716-5p	CLIP-seq
MIRT2530997	hsa-miR-4717-5p	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT2530998	hsa-miR-4723-5p	CLIP-seq
MIRT2530999	hsa-miR-4763-5p	CLIP-seq
MIRT2531000	hsa-miR-4768-5p	CLIP-seq
MIRT2531001	hsa-miR-4778-3p	CLIP-seq
MIRT2531002	hsa-miR-4781-3p	CLIP-seq
MIRT2531003	hsa-miR-4787-5p	CLIP-seq
MIRT2531004	hsa-miR-4793-5p	CLIP-seq
MIRT2531005	hsa-miR-4796-3p	CLIP-seq
MIRT2531006	hsa-miR-483-3p	CLIP-seq
MIRT2531007	hsa-miR-485-3p	CLIP-seq
MIRT2680786	hsa-miR-500b	CLIP-seq
MIRT2531008	hsa-miR-510	CLIP-seq
MIRT2531009	hsa-miR-512-5p	CLIP-seq
MIRT2531010	hsa-miR-518a-5p	CLIP-seq
MIRT2531011	hsa-miR-520g	CLIP-seq
MIRT2531012	hsa-miR-520h	CLIP-seq
MIRT2531013	hsa-miR-527	CLIP-seq
MIRT2531014	hsa-miR-539	CLIP-seq
MIRT2531015	hsa-miR-545	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT2531016	hsa-miR-548c-3p	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT2531017	hsa-miR-548p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT2531018	hsa-miR-587	CLIP-seq
MIRT2531019	hsa-miR-607	CLIP-seq
MIRT2531020	hsa-miR-608	CLIP-seq
MIRT2531021	hsa-miR-625	CLIP-seq
MIRT2531022	hsa-miR-628-3p	CLIP-seq
MIRT2680787	hsa-miR-650	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT2531023	hsa-miR-760	CLIP-seq
MIRT2531024	hsa-miR-767-3p	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT2531025	hsa-miR-942	CLIP-seq

Show/Hide all (33)

Transcription factor	Regulation	Reference
ATF2	Unknown	19670268
ATM	Activation	19502594
EGR1	Repression	9300687
FOS	Activation	10903433
GLI1	Repression	21135115
GLI2	Repression	21135115
HDGF	Activation	19710540
JUN	Activation	10903433
JUN	Unknown	19670268
NFKB1	Activation	19628709;9733827
NFKB1	Repression	16784892
NFKB1	Unknown	10022897;10871852;16317104;7528667
NFKBIA	Repression	9733827
NFYA	Unknown	9261184
NFYB	Unknown	9261184
NFYC	Unknown	9261184
PURA	Repression	10903433
RELA	Activation	19628709;9733827
RELA	Repression	16784892
RELA	Unknown	10871852;16317104
SP1	Activation	22084312
SP1	Unknown	10022897;10871852;9261184;9300785
SREBF1	Activation	18420801
SREBF1	Unknown	12531699;20173757;9300785
SREBF2	Unknown	9300785
STAT1	Unknown	16317104
STAT3	Activation	15223310
STAT3	Repression	16651438;22313388
TFAP2A	Unknown	7528667
TP53	Activation	10101800;11313989
TP53	Unknown	16317104
YBX1	Repression	10903433
YY1	Repression	16784892;17530016

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	IDA	12221075
GO:0005515	Function	Protein binding	IPI	7536190, 7538907, 10918185, 11003656, 11495919, 11606059, 12724420, 12887920, 15465831, 15917238, 16498403, 17047155, 17159907, 18328427, 18846110, 19118384, 20935634, 20956295, 21109225, 21382479, 21625644, 21713032, 21803845, 25241761, 26942442, 33961781
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005516	Function	Calmodulin binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	NAS	7533181
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21625644
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IDA	9681877
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1375228, 10871852
GO:0006924	Process	Activation-induced cell death of T cells	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9360929
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9333124, 12221075
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	22891283
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019900	Function	Kinase binding	IPI	7538908
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	20935634
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IBA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IMP	11096076
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	11096076
GO:0036337	Process	Fas signaling pathway	IDA	12221075
GO:0036337	Process	Fas signaling pathway	IMP	11096076
GO:0038023	Function	Signaling receptor activity	NAS	7533181
GO:0038023	Function	Signaling receptor activity	TAS	1375228
GO:0042802	Function	Identical protein binding	IPI	7536190, 7538908, 21382479
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	NAS	7533181
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21625644
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20935634
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7510905
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	21382479
GO:0045121	Component	Membrane raft	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	10875918
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071455	Process	Cellular response to hyperoxia	IMP	21382479
GO:0097049	Process	Motor neuron apoptotic process	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	22891283
GO:0097527	Process	Necroptotic signaling pathway	IBA
GO:0097527	Process	Necroptotic signaling pathway	IMP	16507998
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IDA	12221075
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IMP	11096076

MIM	HGNC	e!Ensembl
134637	11920	ENSG00000026103

P25445

Protein name

Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)

Protein function

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase CASP8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs CASP8 proteolytic activation which initiates the subsequent cascade of caspases

PDB

1DDF , 2NA7 , 3EWT , 3EZQ , 3THM , 3TJE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	85 → 127	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	129 → 165	TNFR/NGFR cysteine-rich region	Domain
PF00531	Death	230 → 314	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. {ECO:0000269|PubMed:7575433}.

Sequence

MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Sequence length

335

Interactions

View interactions

417

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoimmune lymphoproliferative syndrome type 1	Pathogenic; Likely pathogenic	rs121913086, rs2133515017, rs2133539468, rs2133547404, rs1589488640, rs121913080, rs2133384423, rs2119446366, rs2133472134, rs2119445224, rs2133503921, rs2133502090, rs866771343, rs2133504109, rs2133503091 View all (49 more)	RCV001379330 RCV001383293 RCV001383519 RCV001388141 RCV001382234 RCV001382235 RCV002573298 RCV001878381 RCV001928326 RCV001900407 RCV001987558 RCV001977467 RCV001949292 RCV001884965 RCV001993142 RCV002006613 RCV001939671 RCV002051252 RCV002262183 RCV003517361 RCV002305674 RCV002283777 RCV002464990 RCV003062287 RCV003062288 RCV003058262 RCV003062289 RCV003037351 RCV003037352 RCV003037353 RCV002825303 RCV002810783 RCV002863795 RCV003009179 RCV003011781 RCV003047954 RCV001382236 RCV003517918 RCV003518769 RCV003518770 RCV003518771 RCV003634587 RCV003819549 RCV003517125 RCV001071386 RCV002513090 RCV000638906 RCV001382233 RCV003885402 RCV001051234 RCV000701568 RCV000704333 RCV000695507 RCV000735216 RCV000797871 RCV000805931 RCV000822092 RCV000799837 RCV000853326 RCV000988430 RCV000988431 RCV000988432 RCV000988433 RCV001055690 RCV001071835 RCV001067936 RCV001050531 RCV001070775 RCV001067019 RCV001856272
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME, TYPE IA	Pathogenic	rs606231361, rs606231362, rs121913076, rs606231363, rs121913077, rs28929498, rs121913080, rs267607122, rs606231364, rs606231365, rs121913085, rs606231366, rs121913086	RCV000017961 RCV000017962 RCV000017963 RCV000017964 RCV000017965 RCV000017968 RCV000017969 RCV000017971 RCV000017972 RCV000017973 RCV000017977 RCV000017978 RCV000017979 RCV000017980
FAS-related disorder	Pathogenic	rs866771343	RCV003401971
Inherited Immunodeficiency Diseases	Likely pathogenic; Pathogenic	rs778993919	RCV001027571
Malignant lymphoma, large B-cell, diffuse	Pathogenic	rs1589488640	RCV005930303
See cases	Likely pathogenic; Pathogenic	rs778993919	RCV002252283
Splenomegaly	Likely pathogenic	rs1554851718	RCV000626571
SQUAMOUS CELL CARCINOMA, BURN SCAR-RELATED, SOMATIC	Pathogenic	rs121913082, rs121913083, rs121913084	RCV000017974 RCV000017975 RCV000017976
Thyroid cancer, nonmedullary, 1	Likely pathogenic; Pathogenic	rs886039359	RCV005895436

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	Benign	rs1571020	RCV005923668
Colon adenocarcinoma	Benign; Likely benign	rs28362322	RCV005891908
Familial cancer of breast	Conflicting classifications of pathogenicity; Benign; Likely benign	rs751798922, rs28362322	RCV005869281 RCV005891907
Gastric cancer	Benign	rs1571020	RCV005923667
Hepatoblastoma	Conflicting classifications of pathogenicity	rs143318339	RCV001843539
Hepatocellular carcinoma	Benign; Likely benign	rs28362322	RCV005891909
Ovarian serous cystadenocarcinoma	Benign	rs202165529	RCV005928034
Squamous cell carcinoma of the head and neck	-	rs1214700896	RCV005930030
Thymoma	Benign; Likely benign	rs28362322	RCV005891910
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs28362322	RCV005891911

Show/Hide Text Mining Associations (499)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	23592924, 25910219
Abortion Habitual	Associate	30937706
Acquired Immunodeficiency Syndrome	Associate	11122242, 15196258, 8781430, 9002958, 9144006
Acrocephalosyndactylia	Associate	23330016
Acute Aortic Syndrome	Associate	36309656
Acute Coronary Syndrome	Associate	11849855, 23330016, 25527700
Acute Disease	Associate	14729783
Acute Kidney Injury	Associate	26477820, 28814331
Acute Lung Injury	Associate	12414525, 16183668, 18310897, 20813889
Acute Retroviral Syndrome	Associate	9144006
Adenocarcinoma	Associate	12124829, 16343245, 21390183, 25596086
Adenocarcinoma of Lung	Associate	14614329, 26313705, 31109596, 38204755
Adenoma	Stimulate	11005209
Adenoma	Inhibit	15274324
Adenoma	Associate	16219172
Adrenoleukodystrophy	Associate	10807785
adult multisystem inflammatory disease COVID 19 related	Inhibit	37092638
AIDS Associated Nephropathy	Associate	22775001
Airway Obstruction	Associate	17118637
Alveolitis Extrinsic Allergic	Associate	12608434
Alzheimer Disease	Associate	15538542, 19766542, 29091582, 29343717
Amyloidosis	Associate	27069257, 7540067
Anemia	Associate	32628088
Anemia Aplastic	Associate	11167757, 11564081, 14617023, 9538630, 9580207
Anemia Aplastic	Stimulate	11380462
Anemia Hemolytic	Associate	8929361
Anemia Hemolytic Autoimmune	Associate	31191551
Anemia Refractory with Excess of Blasts	Associate	9792306
Aortic Aneurysm Abdominal	Associate	17350784
Arthritis	Associate	22687048
Arthritis	Inhibit	26763436
Arthritis Juvenile	Associate	20462799, 36362342
Arthritis Psoriatic	Stimulate	7747803
Arthritis Rheumatoid	Associate	10088775, 10403282, 10817565, 12296865, 12746897, 12855687, 15457448, 16508940, 16646028, 17360386, 20187936, 21155991, 24452947, 29880835, 33042152 View all (7 more)
Arthritis Rheumatoid	Stimulate	10225817
Asthma	Associate	10704078, 10710535, 12234263, 17460949, 30864351
Asthma	Inhibit	24641294
Astrocytoma	Associate	19740103
Ataxia Telangiectasia	Associate	22649200, 24603338
Atherosclerosis	Associate	11407740, 17053166, 21646352
Atrophy	Associate	11171836, 11641530, 18383830
Attention Deficit Disorder with Hyperactivity	Associate	21651830
Autoimmune Diseases	Associate	10513814, 10515860, 10632670, 10807785, 11454987, 12081238, 12149230, 12199788, 12516573, 12855571, 12855687, 12930371, 15178337, 15870181, 16108814 View all (15 more)
Autoimmune Diseases of the Nervous System	Associate	10513797, 24760111, 9927496
Autoimmune Lymphoproliferative Syndrome	Associate	10090885, 10200300, 10340403, 10487849, 10513797, 10515860, 10691859, 10709732, 10807785, 10931153, 11342444, 11380411, 11418480, 11588044, 11830507 View all (65 more)
Barrett Esophagus	Associate	16049281, 20934723
Behcet Syndrome	Associate	15986355, 8814751
Bile Duct Neoplasms	Associate	15794670
Bone Diseases	Associate	15287939, 9333124
Bone Marrow Diseases	Associate	27846610
Bone Marrow Failure Disorders	Associate	11342425, 14617023, 9792306
Brain Injuries	Associate	37395036
Brain Ischemia	Stimulate	17241480
Brain Neoplasms	Associate	20501759, 26858129, 8878461
Breast Neoplasms	Associate	10364198, 10391843, 10574967, 10651943, 11070347, 11786482, 12221075, 12223126, 12788915, 14625298, 17352235, 18593367, 19126655, 20204402, 2022639 View all (14 more)
Breast Neoplasms	Stimulate	18022396, 18507020
Breast Neoplasms	Inhibit	24916571, 34092611
Burkitt Lymphoma	Associate	10477698, 12139737, 1375228, 1375849, 27641442, 28509416, 37569852, 7595225, 8695856, 9733827
Burns	Associate	22876141
Carcinogenesis	Associate	10638979, 11857317, 12651942, 12941126, 15864586, 15937082, 16091761, 17597021, 18679533, 20222173, 23280017, 26617948, 26823709
Carcinogenesis	Inhibit	16224150
Carcinoma	Inhibit	11005209
Carcinoma Basal Cell	Associate	16638418, 32382535, 8691726, 9389732
Carcinoma Ductal Breast	Inhibit	12173320
Carcinoma Hepatocellular	Associate	10735508, 11315506, 12861043, 14669310, 15849812, 16080799, 18679533, 21288283, 23874836, 24761872, 25085585, 25543761, 25596532, 28246474, 33602168 View all (5 more)
Carcinoma Intraductal Noninfiltrating	Associate	12173320
Carcinoma Medullary	Associate	18469794
Carcinoma Non Small Cell Lung	Associate	10817513, 12458337, 16224150, 18757527, 21744322, 23237220, 23378343, 24128051, 26823709, 32963220
Carcinoma Ovarian Epithelial	Associate	15710431, 17465232, 37868997
Carcinoma Pancreatic Ductal	Inhibit	12173320
Carcinoma Papillary	Stimulate	17597021
Carcinoma Renal Cell	Associate	10782148, 10839301, 10999463, 12460460, 12941126, 15188008, 19920202, 19940360, 31097685
Carcinoma Squamous Cell	Associate	10620127, 11121139, 15698511, 18949744, 21808135, 25976983
Carcinoma Transitional Cell	Associate	11355943
Cardiomyopathies	Associate	16168288
Cardiomyopathy Dilated	Associate	10201613
Cardiovascular Diseases	Associate	19718569, 24393375
Carrington syndrome	Associate	11334118
CD59 Deficiency	Associate	10513797
Cell Transformation Neoplastic	Associate	31992798
Central Nervous System Diseases	Associate	10513797
Chemical and Drug Induced Liver Injury	Associate	10980054, 27243827, 7595193
Cholangiocarcinoma	Associate	11854917, 15794670, 29089545
Cholangitis Sclerosing	Stimulate	29089545
Choroidal Effusions	Associate	17985388
Chromosome 7 monosomy	Inhibit	12393649
Chromosome 8 trisomy	Associate	12393649
Churg Strauss Syndrome	Associate	10487849, 16968898
Cicatrix	Associate	10620127
Coinfection	Stimulate	36443691
Colitis Ulcerative	Associate	16049281, 19653342
Coloboma	Associate	8814751
Colonic Neoplasms	Associate	10097131, 10744679, 10941902, 11477113, 11761438, 12865931, 15831912, 15864586, 16273638, 19341712, 20039457, 9223329
Colonic Neoplasms	Inhibit	23604035
Colorectal Neoplasms	Associate	10079247, 10098769, 10638979, 11173732, 11300326, 11896073, 15494722, 16273638, 17436592, 18364356, 18609706, 19266094, 19298528, 19483104, 20573240 View all (15 more)
Colorectal Neoplasms	Inhibit	15274324, 9472684
Common Variable Immunodeficiency	Associate	10403927, 11472434
Common Variable Immunodeficiency	Stimulate	7554385
Congenital contractural arachnodactyly	Stimulate	29089545
Corneal Dystrophies Hereditary	Associate	14502125, 20680100, 21135107
Corneal dystrophy epithelial basement membrane	Associate	20680100
Corneal Endothelial Cell Loss	Associate	35638591
Coronary Artery Disease	Stimulate	11882051
Coronary Disease	Stimulate	28796044
COVID 19	Stimulate	32679621
COVID 19	Associate	32783921, 34402426, 36119078, 36876702
Crohn Disease	Associate	15479684, 19653342, 31663908, 36916302
Cryptogenic Organizing Pneumonia	Associate	21144722
Cystic Fibrosis	Associate	10567629, 12000003, 28106773
Cytomegalovirus Infections	Associate	10931153, 14725906
Death	Associate	10716473, 11279061, 12060388, 12694389, 17912028, 23894399, 29092660, 37798436
Death	Stimulate	23721745
Death Sudden	Associate	11970950
Deltaretrovirus Infections	Associate	21971214
Demyelinating Diseases	Associate	8976190
Dental Plaque	Associate	11241135
Depressive Disorder Major	Associate	27232630
Dermatitis Atopic	Associate	12542799, 30286163
Dermatitis Contact	Associate	7521376
Dermatitis Herpetiformis	Associate	16388717, 22778762
Diabetes Mellitus	Associate	12060768, 28106773
Diabetes Mellitus Type 1	Associate	22519592, 9334358
Diabetes Mellitus Type 2	Associate	24178789, 24393375, 30024959
Dianzani autoimmune lymphoproliferative syndrome	Associate	16720836, 22983577, 24398331, 24894771
Diarrhea Chronic with Villous Atrophy	Associate	14991945
DiGeorge Syndrome	Associate	9697985
Disease	Associate	11511560, 11529933, 14991945, 7510716, 9373236
DNA Virus Infections	Associate	8652825
Drug Fever	Stimulate	11675354
Drug Hypersensitivity	Associate	8639900
Drug Related Side Effects and Adverse Reactions	Associate	10323451, 10381522, 10556193, 10948650, 11511560, 11675354, 11739185, 12824926, 12855571, 12855687, 14576041, 15188008, 17490628, 18497573, 19483104 View all (13 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	21135115, 8681376
Drug Related Side Effects and Adverse Reactions	Inhibit	23856078
Dysentery Bacillary	Associate	12011015
Dyserythropoiesis Congenital with Internuclear Chromatin Bridges and Ultrastructurally Normal Erythroblast Heterochromatin	Associate	10691859
Eczema	Associate	10880045
Endometrial Neoplasms	Associate	28656791
Endometriosis	Associate	29226157, 30036894, 31566051
Endotoxemia	Associate	27857173
Enterocolitis Neutropenic	Stimulate	12911946, 14965872
Eosinophilia	Associate	8642249, 9692873
Epilepsy Temporal Lobe	Associate	27006531
Epstein Barr Virus Infections	Associate	11504544, 11673559, 20193111, 33297669
Erythema Multiforme	Associate	17880768, 7521376
Esophageal Neoplasms	Associate	16186185, 16394289, 17912028, 23921907, 24473454, 25085585, 26819081
Esophageal Squamous Cell Carcinoma	Associate	16394289, 17187659, 20438666, 20934723, 21926110, 24473454
Evans Syndrome	Associate	30940614
Exanthema	Associate	10513797
Extranodal Extension	Associate	9787134
Farber Lipogranulomatosis	Associate	11641773
Fatty Liver	Associate	23110339, 25474087, 33096687
Fatty Liver Alcoholic	Stimulate	25474087
Fever	Stimulate	23527624
Fever	Associate	36119078
Fibroadenoma	Associate	22842170
Fibrocartilaginous embolism	Associate	23923075
Fibrosis	Associate	15833141, 27857173
Fibrosis	Inhibit	27243827
Fibrous Dysplasia Polyostotic	Associate	10807785
Fractures Spontaneous	Associate	23938324
Frontotemporal Lobar Degeneration	Associate	18420483, 21048198
Fuchs' Endothelial Dystrophy	Associate	25169582
Gallbladder Neoplasms	Associate	15968727
Gastritis Atrophic	Associate	21864388
Gastrointestinal Neoplasms	Associate	20682655, 25333257
Gastrointestinal Stromal Tumors	Associate	18941456
GATA2 Deficiency	Associate	12466128, 31908105
Genetic Diseases Inborn	Associate	12930371, 32628088, 33995372, 35264221, 35655776, 9373236
Giant Cell Tumor of Bone	Associate	10948650
Glioblastoma	Associate	18594817, 24130787, 24561085, 27124583, 34638742, 9217971
Glioma	Associate	10361224, 11050476, 11557035, 11770895, 11784850, 12496285, 18594817, 18710416, 22406992, 25556484, 29164574, 36602390, 7521890, 7537727, 8641993 View all (5 more)
Goiter Nodular	Associate	29250672
Graft vs Host Disease	Associate	10192442, 11222367
Granulomatous Disease Chronic	Associate	9645360
Granulosa Cell Tumor	Associate	26911253, 29401296
Granulosa cell tumor of the ovary	Associate	10948650
Graves Disease	Associate	10780664, 11422195, 12930371, 16219172, 18324486, 19008632
Groenouw type I corneal dystrophy	Associate	20680100, 24129074
Guillain Barre Syndrome	Associate	29432441
Hashimoto Disease	Associate	11005209, 12480911, 12930371, 18324486
Hashimoto Disease	Stimulate	16219172
Hearing Disorders	Associate	32628088
Hearing Loss Noise Induced	Associate	38212800
Heart Diseases	Associate	10201613
Heart Failure	Associate	21935395, 22790687
Heart Neoplasms	Associate	26617948
Hemangiosarcoma	Associate	11549589
Hematologic Diseases	Associate	20360470, 34187243
Hematologic Neoplasms	Associate	11166462
Hemoglobinuria Paroxysmal	Associate	10974022, 14617023
Hemoglobinuria Paroxysmal	Stimulate	12135676
Hemolysis	Associate	10340403
Hemorrhagic Fever Ebola	Associate	28558022
Hepatitis B	Associate	10468853
Hepatitis B	Inhibit	30209179
Hepatitis C	Associate	10540162, 10930983, 27243827
Hepatitis C Chronic	Associate	10930983, 18679533
Hepatitis Chronic	Stimulate	15457575
Hereditary Breast and Ovarian Cancer Syndrome	Associate	10716717, 12398896
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	18796435
Hereditary leiomyomatosis and renal cell cancer	Associate	10658674, 11376869, 11943736, 15078899
Herpes Simplex	Associate	29717769
Herpes Zoster	Associate	7521376
Hippocampal Sclerosis	Associate	27006531
Histiocytic Sarcoma	Associate	20216376
HIV Infections	Associate	10337023, 10419894, 10481067, 10556193, 10792383, 11375056, 11449406, 11800643, 12208869, 15196258, 18441236, 18495780, 22194871, 22775001, 26452480 View all (11 more)
HIV Infections	Stimulate	11122240, 7587741
Hodgkin Disease	Associate	10329597, 10340403, 11376869, 11830507, 11943736, 15078899, 15096587, 20216376, 27846610, 9054667, 9769119
HTLV I Infections	Associate	21971214, 25411246, 9384300
HTLV I Infections	Stimulate	8781430
Huntington Disease	Associate	11943736, 34802797
Huntington Disease	Inhibit	11972629
Hypergammaglobulinemia	Associate	10513797
Hypermethioninemia	Associate	21063026
Hyperparathyroidism Primary	Associate	27763797
Hyperplasia	Associate	10780664, 27763797
Hypertension	Stimulate	17558734, 30171418
Hypertension	Associate	30864351
Hyponatremia	Associate	36119078
Hypothermia	Inhibit	19596001
Hypoxia	Associate	17118637, 24927122
Idiopathic Interstitial Pneumonias	Associate	12480919, 21196285
Idiopathic Noncirrhotic Portal Hypertension	Associate	27857173
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	9510393
Idiopathic Pulmonary Fibrosis	Associate	11334117, 23580232, 27218286
IgA Vasculitis	Associate	10323451, 10817565, 16646028, 16734620, 17393415
IgA Vasculitis	Stimulate	8587248
IgG Deficiency	Inhibit	9409648
Immune System Diseases	Associate	24927122, 35687490
Immunologic Deficiency Syndromes	Associate	22174160, 22649200, 9002958
Incontinentia Pigmenti	Associate	9817169
Infections	Inhibit	10481067
Infections	Associate	11292757, 11800643, 15196258, 18383830, 32373555, 9645360
Infections	Stimulate	9447238
Infectious Mononucleosis	Associate	10552954, 1320953
Infectious Mononucleosis	Stimulate	26109734
Infertility	Associate	23218678
Inflammation	Associate	10079247, 10225817, 10464273, 10980054, 14514471, 15538542, 17903520, 20813889, 21144722, 24178789, 24359166, 24903614, 24927122, 25501066, 30171418, 8814751, 9333124 View all (2 more)
Inflammatory Bowel Diseases	Stimulate	10225817
Inflammatory Bowel Diseases	Associate	15637757, 19653342, 32519954
Insulin Resistance	Associate	24178789, 30024959
Interleukin 2 Receptor Alpha Deficiency of	Associate	9573033
Intervertebral Disc Degeneration	Associate	27593829, 34925543, 35613904
Intervertebral disc disease	Associate	34925543, 35613904
Intervertebral Disc Displacement	Associate	23141929
Intestinal Diseases	Associate	18383830
Intestinal Neoplasms	Associate	18473402
Intracranial Aneurysm	Associate	36451838
Kashin Beck Disease	Associate	31762289
Keratoconus	Associate	25169582
Kidney Diseases	Associate	17034587
Kidney Neoplasms	Associate	19417161
Klatskin Tumor	Associate	11854917
Laryngeal Neoplasms	Associate	18949744, 33415169
Lattice corneal dystrophy type 1	Associate	24302499, 25910219
Lead Poisoning Nervous System	Associate	11099494
Leiomyosarcoma	Associate	31754707
Leukemia	Associate	10539881, 10556200, 11238127, 11675354, 11739185, 12149230, 12244143, 15102480, 17129359, 17376892, 17561974, 17673463, 18056484, 18403639, 18477771 View all (11 more)
Leukemia	Stimulate	15699173
Leukemia Hairy Cell	Associate	10601997, 7682455
Leukemia Hairy Cell	Inhibit	35476232
Leukemia Large Granular Lymphocytic	Associate	10887130, 11160159, 12149230, 16484592, 17993614, 35015834, 9845544
Leukemia Lymphocytic Chronic B Cell	Associate	10520003, 11675354, 12901972, 15521917, 15914559, 16741250, 18434611, 18945750, 20882050, 33639675, 9432034, 9596676, 9680373, 9787134, 9858222
Leukemia Lymphoma Adult T Cell	Associate	10190897, 10606894, 11472346, 7684622, 9144006, 9573032
Leukemia Mast Cell	Associate	16455983
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10907639, 11166462, 19091943, 21321117, 26563376, 27009330, 9028327, 9680367
Leukemia Myeloid	Associate	10556200
Leukemia Myeloid Acute	Associate	10539881, 11739185, 15203866, 19047119, 22733023, 9012700, 9389707
Leukemia Plasma Cell	Associate	7544648
Leukemia Prolymphocytic T Cell	Associate	10520029, 9163608, 9432034
Leukemia Promyelocytic Acute	Associate	11698395, 11918536, 22084312
Leukemia T Cell	Associate	10210778, 15004200, 9155645
Leukoencephalopathies	Associate	33189883, 8976190
Lichen Planus Oral	Associate	21133638
Lichenoid Eruptions	Associate	7521376
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Associate	22775001
Liver Cirrhosis	Associate	25543761, 9510393
Liver Cirrhosis Biliary	Associate	21636249
Liver Diseases	Associate	10980054, 11099494, 18679533, 27243827
Liver Failure	Associate	10540162, 18679533, 23114924, 24218069
Liver Failure Acute	Associate	8567993
Lung Diseases	Associate	12414525, 15833141, 26617708, 9817169
Lung Diseases Interstitial	Associate	21144722, 9817169
Lung Injury	Associate	15161631, 20813889
Lung Neoplasms	Associate	10655513, 12824926, 14614329, 15937082, 16186185, 17708363, 18757527, 21430781, 22393947, 23506616, 24128051, 32963220
Lung Neoplasms	Stimulate	15704653
Lupus Erythematosus Discoid	Associate	16638418, 26261624
Lupus Erythematosus Systemic	Stimulate	10225817, 10323442, 17034587, 17162369, 21398610, 26090500, 7531628
Lupus Erythematosus Systemic	Associate	10513797, 10632670, 11168009, 11171685, 16108814, 18050247, 18512812, 19180486, 19404947, 19644848, 24348139, 26076826, 27211902, 7510716, 8787672, 9754553, 9822266 View all (2 more)
Lupus Nephritis	Associate	17034587
Lupus Nephritis	Stimulate	8587248
Lymphatic Diseases	Associate	12199788, 7510716, 9028321, 9927496
Lymphatic Metastasis	Inhibit	15052671
Lymphatic Metastasis	Associate	25543761, 27524883, 28032929
Lymphoma	Associate	10362803, 11380411, 11418480, 11454987, 12199788, 14982861, 15009062, 15459303, 17090655, 17210689, 24398331, 29504848, 31689275, 39843653, 7684622 View all (5 more)
Lymphoma AIDS Related	Associate	9056740
Lymphoma B Cell	Associate	10468853, 10513797, 11120779, 11418480, 11454987, 11673559, 12139737, 15459303, 27558422, 28509416, 28732145, 39843653, 7682455, 8956976, 9163608, 9846961 View all (1 more)
Lymphoma B Cell	Stimulate	23135171
Lymphoma B Cell Marginal Zone	Associate	11454987, 14982861, 29481902, 9787134
Lymphoma Extranodal NK T Cell	Associate	31908105
Lymphoma Follicular	Associate	10782148, 39843653, 7519826, 7682455, 9787134, 9858217
Lymphoma Large B Cell Diffuse	Associate	11380411, 11454987, 14982861, 16628716, 21693768, 35687490, 40302006, 9531598, 9787134, 9846961
Lymphoma Large Cell Anaplastic	Associate	16304056, 9787134
Lymphoma Mantle Cell	Associate	11468180, 9792311
Lymphoma Non Hodgkin	Associate	10468853, 11418480, 16081784, 19048401, 7519826, 8956976, 9163608, 9683298, 9787134
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	11121138, 19890350
Lymphoma T Cell	Associate	10340403, 12460460, 24603338, 37160920, 9375749
Lymphoma T Cell Cutaneous	Associate	10886511, 15816832, 17495957, 20231830, 21036138, 25140833, 26302991, 29675945
Lymphoma T Cell Cutaneous	Inhibit	18923451
Lymphopenia	Associate	10513797, 22649200, 32628088, 37848421, 7531628
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	10403927, 11375056, 18441236
Lymphoproliferative Disorders	Associate	10515860, 11673559, 12149230, 29686686, 33170215, 8929361
Malaria	Associate	14991945, 21625619
Malaria	Stimulate	19877016
Malaria Cerebral	Associate	21625619
Malaria Falciparum	Associate	26617708
Malformations of Cortical Development Group I	Associate	20476668
Mandibular Nerve Injuries	Associate	29432441
Measles	Associate	29717769
Meckel syndrome type 1	Associate	10793071
Melanoma	Associate	10318823, 10361224, 10362803, 10383736, 10497214, 10802053, 11121134, 11225993, 11511312, 12230495, 12672071, 15492115, 16004605, 16306044, 16487513 View all (6 more)
Melanoma Cutaneous Malignant	Associate	10362803, 11857317, 19626699
Meningioma	Associate	11583945
Metabolic Diseases	Associate	10716717
Microsatellite Instability	Associate	28300842
Minicore Myopathy with External Ophthalmoplegia	Associate	28362510
Mitochondrial Diseases	Associate	18765530, 23166734
Monoclonal Gammopathy of Undetermined Significance	Associate	7540067
Mouth Neoplasms	Associate	21808135
Mucocutaneous Lymph Node Syndrome	Associate	11703382
Multiple Myeloma	Associate	10381522, 11101147, 11222356, 12036884, 15860671, 15963854, 17384201, 21912642, 22838736, 27405696, 32840410, 7530506, 7540067, 7540069, 7544648 View all (7 more)
Multiple Sclerosis	Associate	11238569, 12188927, 21437244, 31228212, 8879222, 8976190
Multiple Sclerosis Relapsing Remitting	Inhibit	24793898
Muscular Atrophy Spinal	Associate	22723941
Muscular Dystrophy Duchenne	Stimulate	20476668
Muscular Dystrophy Duchenne	Associate	28988748
Myasthenia Gravis	Associate	15049785, 15454488, 9129034
Mycobacterium Infections Nontuberculous	Stimulate	16721821
Mycosis Fungoides	Associate	12060388, 28206666
Myelodysplastic Syndromes	Associate	10460607, 11861273, 15677568, 23604035, 26910909, 9792306, 9868964
Myocardial Infarction	Associate	11849855, 11970950, 14711179
Myopathies Structural Congenital	Stimulate	33189883
Myositis	Associate	19740320
Nasopharyngeal Carcinoma	Associate	10929762, 32119704, 37217794
Necrosis	Stimulate	9217971
Neoplasm Metastasis	Associate	10079247, 11300326, 22875006, 23280017, 24264315, 24595049, 25333257, 25543761, 26617948, 28032929, 28300842
Neoplasm Metastasis	Inhibit	15274324, 17352235, 28000850
Neoplasms	Associate	10079247, 10340403, 10361224, 10362803, 10391843, 10468284, 10556200, 10606894, 10620127, 10716717, 10735508, 10780525, 10782148, 10807785, 10817504 View all (156 more)
Neoplasms	Inhibit	11120779, 14592832, 15937082, 17708363, 22875006, 24122668, 29382334, 31054930, 32963220, 33430890, 9722299
Neoplasms	Stimulate	18594006, 20573240, 27124583
Neoplasms Adipose Tissue	Associate	24178789
Neoplasms Cystic Mucinous and Serous	Associate	21317880
Neoplasms Ductal Lobular and Medullary	Associate	38046195
Neoplasms Germ Cell and Embryonal	Associate	31744479
Neoplasms Glandular and Epithelial	Associate	16164629
Neoplasms Hormone Dependent	Associate	22842170
Neoplasms Second Primary	Associate	20501759, 26858129
Neoplasms Squamous Cell	Associate	18225575
Nerve Degeneration	Associate	19766542
Neuroblastoma	Associate	12841868, 14617634, 17962944, 23034519, 23951214, 25695505, 9096388, 9533769
Neurodegenerative Diseases	Associate	15364960, 25695505
Neuroectodermal Tumors	Associate	9354463
Neutropenia	Associate	15196258, 31191551
Neutropenia	Stimulate	18819843
Niemann Pick Disease Type A	Associate	22771321, 9321399
Niemann Pick Disease Type C	Associate	19762521, 35613904
Niemann Pick Diseases	Associate	9516458
NOG Related Symphalangism Spectrum Disorder	Associate	12651606
Non alcoholic Fatty Liver Disease	Associate	25474087, 34063472, 36771140
Non alcoholic Fatty Liver Disease	Stimulate	31388096
Obesity	Associate	24178789, 25474087
Obesity	Inhibit	26694359, 26763436
Obesity	Stimulate	30171418
Oculopalatocerebral Syndrome	Associate	26858129
Oligospermia	Associate	17123522
Optic Atrophy Hereditary Leber	Associate	11741983
Optic Nerve Glioma	Associate	11050476
Oral Ulcer	Associate	10513797
Oropharyngeal Neoplasms	Associate	25976983
Osteoarthritis	Associate	11508432, 12932288, 14872492
Osteoarthritis	Stimulate	31762289
Osteoarthritis Knee	Associate	12932288
Osteosarcoma	Associate	19066961, 19911702, 22502718, 22875006, 24595049, 29045512, 34335109
Ovarian Neoplasms	Associate	11290551, 12637505, 16093247, 19910452, 19959214, 25446129, 29910195, 32503653, 37838774, 39608974, 8824809
Pancreatic Neoplasms	Associate	10714630, 11115536, 12173320, 14583775, 16109447, 17695548, 22670178, 24551298, 37625401, 37699334
Pancreatitis	Associate	9334358
Pancreatitis Chronic	Associate	11310825, 11889077
Panniculitis Lupus Erythematosus	Associate	26261624
Paraparesis Tropical Spastic	Associate	21971214, 9144006
Parapsoriasis	Associate	18923451
Parathyroid Diseases	Associate	27763797
Parathyroid Neoplasms	Associate	27763797
Parkinson Disease	Stimulate	26236736
Pemphigoid Bullous	Associate	16388717, 27868136, 7521376
Pemphigus	Associate	15178337, 7521376
Penile Induration	Associate	11241135, 23356197
Peripheral Nervous System Diseases	Associate	10513797
Peritonitis	Stimulate	18350449
Plaque Atherosclerotic	Associate	11241135, 11970950
Pleural Effusion Malignant	Associate	12824926
POEMS Syndrome	Associate	31191551
Polycystic Ovary Syndrome	Associate	35393909
Polycythemia Vera	Associate	15178337, 16384930
Pre Eclampsia	Associate	22837649
Pre Eclampsia	Stimulate	37921073, 39889763
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17376892, 18552209, 24218069, 30206207, 9207432, 9573033
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10930993, 11703324, 15203866, 21509038, 9722299
Primary Immunodeficiency Diseases	Associate	30940614, 32265901, 35264221, 38644452
Progressive Transformation of Germinal Centers	Associate	17548807
Prostatic Diseases	Associate	11310821
Prostatic Hyperplasia	Associate	16309180, 16827116
Prostatic Intraepithelial Neoplasia	Associate	11310821, 17203870
Prostatic Intraepithelial Neoplasia	Stimulate	12124829
Prostatic Neoplasms	Associate	10722700, 10839298, 11020350, 12432255, 15556626, 16207477, 25085585, 25679447, 26716643
Prostatitis	Associate	12124829, 14766760, 16309180, 16397262, 25679447, 28984341
Prosthesis Failure	Associate	19565496
Protein Energy Malnutrition	Stimulate	19731773
Proteinuria	Associate	8587248
Psoriasis	Inhibit	26763436
Pulmonary Disease Chronic Obstructive	Associate	10704078, 17118637, 25137293
Pulmonary Disease Chronic Obstructive	Stimulate	30171418
Pulmonary Edema	Associate	12414525, 26617708
Pulmonary Fibrosis	Associate	15833141, 9817169
Purpura Thrombocytopenic Idiopathic	Associate	12199788, 16368066, 17725802, 18519809, 26969086, 27391055
Purpura Thrombotic Thrombocytopenic	Associate	9028945
Purpura Thrombotic Thrombocytopenic	Stimulate	9949169
Pyoderma Gangrenosum	Associate	24903614, 25501066
Reperfusion Injury	Stimulate	19596001
Respiratory Distress Syndrome	Associate	12414525, 15161631, 19164355
Retinal Dysplasia	Associate	17187659
Retinoblastoma	Associate	15378505
Rupture	Associate	11970950
Sarcoidosis	Associate	18588573, 37863732
Sarcoidosis	Stimulate	26376720
Sarcoma	Associate	18506556
Sarcoma Ewing	Associate	17695539, 22382690, 25025207, 9846984
Schizophrenia	Inhibit	30560506
Scleroderma Diffuse	Associate	19950259
Scleroderma Systemic	Stimulate	15188368
Scleroderma Systemic	Associate	16108814, 19950259
Sepsis	Associate	24398331
Sertoli Cell Only Syndrome	Associate	17123522
Severe Combined Immunodeficiency	Associate	32265901
Sezary Syndrome	Inhibit	18923451
Sezary Syndrome	Associate	19759548
Shock Septic	Associate	23721745
Shwachman Diamond Syndrome	Associate	11342425
Silicosis	Associate	10632670, 14514471, 16108814, 9367417, 9741350
Silicosis	Stimulate	21244759
Sjogren's Syndrome	Stimulate	10446867
Sjogren's Syndrome	Associate	11204278, 12528117, 14672901, 15692983, 17075845, 21128999, 25062418, 29504848, 37353767, 9844061
Skin Diseases	Associate	15178337, 9008237
Skin Manifestations	Associate	11342444, 9028321
Sleep Apnea Obstructive	Associate	30171418
Sleep Deprivation	Associate	30551620
Sleep Deprivation	Stimulate	8652825, 9060702
Small Cell Lung Carcinoma	Associate	20470393
Somatoform Disorders	Associate	8642249
Splenomegaly	Associate	10340403, 9028321, 9927496
Spondylitis Ankylosing	Associate	29960293
Squamous Cell Carcinoma of Head and Neck	Associate	15039212, 18225575, 20501759, 23894399, 26400345, 28686330, 32628088, 37798436
Squamous Cell Carcinoma of Head and Neck	Inhibit	27628319
Stevens Johnson Syndrome	Associate	17880768, 22992806
Stomach Diseases	Associate	10858249, 14595120, 18383830
Stomach Neoplasms	Associate	12439910, 12944556, 14605879, 15052671, 15991280, 20193111, 20222173, 21526501, 23921907, 24032591, 24065485, 24927122, 26617948, 28000850, 36124496, 37513656, 9045896 View all (2 more)
Stomach Ulcer	Associate	17036384
Syncope	Inhibit	33161103
Synovial Cyst	Associate	12746897, 20187936
Tarlov Cysts	Associate	22670178
Tertiary Lymphoid Structures	Inhibit	28000850
Testicular Germ Cell Tumor	Associate	17643097
Testicular Neoplasms	Associate	21509038
Thrombocytopenia	Associate	31191551, 8929361
Thyroid Neoplasms	Associate	11005209, 16452205, 17597021, 29250672
Thyroiditis	Associate	10464273, 11675676, 19008632
Thyroiditis Autoimmune	Associate	12930371, 16219172, 29250672
Tinnitus	Associate	38212800
Tn Syndrome	Associate	29892290
Toxoplasmosis	Associate	29717769
Triple Negative Breast Neoplasms	Associate	28121628
Tuberculosis	Associate	12780692, 16556259
Tuberculosis Central Nervous System	Associate	22111973
Tuberculosis Meningeal	Associate	30180814
Urethral Neoplasms	Associate	16091761
Urinary Bladder Neoplasms	Associate	11355943, 16101181, 19913990, 22517918, 26798188, 31054930
Urticaria Solar	Stimulate	11857317
Uterine Cervical Neoplasms	Associate	16186185, 16343245, 16515587, 23280017, 25472583, 27765929, 27899077, 31198791, 32390360
Uterine Cervicitis	Associate	16343245
Uterine Cervicitis	Inhibit	23280017
Varicella Zoster Virus Infection	Associate	31191551
Viremia	Associate	15353552
Virus Diseases	Associate	9060702
Vitiligo	Associate	18548110
Vomiting	Associate	28686330
Vulvar Neoplasms	Associate	37382757
Weight Loss	Inhibit	24178789
Weight Loss	Associate	37738560
Werner Syndrome	Associate	20103915
Wiskott Aldrich Syndrome	Stimulate	10666201

FAS (Fas cell surface death receptor)