Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	8772
Gene name	Fas associated via death domain
Gene symbol	FADD
Synonyms (NCBI Gene)	GIG3IMD90MORT1
Chromosome	11
Chromosome location	11q13.3
Summary	The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis fact

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs369869993	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs387906839	T>G	Pathogenic	Missense variant, coding sequence variant
rs863224871	AGCGAGC>-	Likely-pathogenic	Stop gained, coding sequence variant
rs1392069885	G>A	Likely-pathogenic	Missense variant, coding sequence variant

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000638	hsa-miR-146a-5p	Luciferase reporter assay	19965651
MIRT006848	hsa-miR-155-5p	GFP reporter assayImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21706480
MIRT006848	hsa-miR-155-5p	GFP reporter assayImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21706480
MIRT023826	hsa-miR-1-3p	Microarray	18668037
MIRT025869	hsa-miR-7-5p	Sequencing	20371350
MIRT046456	hsa-miR-15b-5p	CLASH	23622248
MIRT736414	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT974914	hsa-miR-1178	CLIP-seq
MIRT974915	hsa-miR-1287	CLIP-seq
MIRT974916	hsa-miR-1288	CLIP-seq
MIRT974917	hsa-miR-28-5p	CLIP-seq
MIRT974918	hsa-miR-3135b	CLIP-seq
MIRT974919	hsa-miR-3139	CLIP-seq
MIRT974920	hsa-miR-3140-3p	CLIP-seq
MIRT974921	hsa-miR-3156-5p	CLIP-seq
MIRT974922	hsa-miR-3159	CLIP-seq
MIRT974923	hsa-miR-3169	CLIP-seq
MIRT974924	hsa-miR-320a	CLIP-seq
MIRT974925	hsa-miR-320b	CLIP-seq
MIRT974926	hsa-miR-320c	CLIP-seq
MIRT974927	hsa-miR-320d	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT974931	hsa-miR-382	CLIP-seq
MIRT974932	hsa-miR-4302	CLIP-seq
MIRT974933	hsa-miR-4429	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT974935	hsa-miR-4462	CLIP-seq
MIRT974936	hsa-miR-4638-3p	CLIP-seq
MIRT974937	hsa-miR-4722-5p	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT974941	hsa-miR-606	CLIP-seq
MIRT974942	hsa-miR-633	CLIP-seq
MIRT974943	hsa-miR-708	CLIP-seq
MIRT1988849	hsa-miR-1183	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988852	hsa-miR-185	CLIP-seq
MIRT1988853	hsa-miR-1913	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT1988858	hsa-miR-3128	CLIP-seq
MIRT1988859	hsa-miR-323-5p	CLIP-seq
MIRT1988860	hsa-miR-324-3p	CLIP-seq
MIRT1988861	hsa-miR-3665	CLIP-seq
MIRT1988862	hsa-miR-3667-3p	CLIP-seq
MIRT1988863	hsa-miR-3688-3p	CLIP-seq
MIRT1988864	hsa-miR-3690	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT1988866	hsa-miR-377	CLIP-seq
MIRT1988867	hsa-miR-378g	CLIP-seq
MIRT1988868	hsa-miR-3919	CLIP-seq
MIRT1988869	hsa-miR-3925-5p	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT1988871	hsa-miR-4254	CLIP-seq
MIRT1988872	hsa-miR-4274	CLIP-seq
MIRT1988873	hsa-miR-4306	CLIP-seq
MIRT1988874	hsa-miR-4330	CLIP-seq
MIRT1988875	hsa-miR-4474-3p	CLIP-seq
MIRT1988876	hsa-miR-4519	CLIP-seq
MIRT1988877	hsa-miR-4524	CLIP-seq
MIRT1988878	hsa-miR-4527	CLIP-seq
MIRT1988879	hsa-miR-4644	CLIP-seq
MIRT1988880	hsa-miR-4645-5p	CLIP-seq
MIRT1988881	hsa-miR-4673	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT1988883	hsa-miR-4738-3p	CLIP-seq
MIRT1988884	hsa-miR-4749-3p	CLIP-seq
MIRT1988885	hsa-miR-4756-3p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT1988890	hsa-miR-548g	CLIP-seq
MIRT1988891	hsa-miR-589	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT2223236	hsa-miR-2861	CLIP-seq
MIRT2223237	hsa-miR-3065-3p	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT2223238	hsa-miR-3160-3p	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT2223239	hsa-miR-3921	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT2223240	hsa-miR-4286	CLIP-seq
MIRT2223241	hsa-miR-4303	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT2223242	hsa-miR-4487	CLIP-seq
MIRT2223243	hsa-miR-4653-5p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT2223244	hsa-miR-4757-5p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT2223245	hsa-miR-558	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
DEDD	Unknown	17193921
RUNX3	Activation	17956589

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	9208847, 21785459
GO:0002376	Process	Immune system process	IEA
GO:0002821	Process	Positive regulation of adaptive immune response	IEA
GO:0002821	Process	Positive regulation of adaptive immune response	ISS
GO:0005123	Function	Death receptor binding	IBA
GO:0005123	Function	Death receptor binding	IEA
GO:0005123	Function	Death receptor binding	TAS	7538907
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7536190, 7538907, 8681376, 9208847, 9343261, 10442631, 10880445, 11112409, 12702765, 12887920, 14612908, 15688372, 16127453, 16498403, 17047155, 17159907, 18328427, 18485876, 18846110, 19060883, 19118384, 19176810, 19524512, 19524513, 20103630, 20890306, 20935634, 21382479, 21458669
GO:0005737	Component	Cytoplasm	IDA	22510408
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21785459
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	22510408
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	22891283
GO:0007165	Process	Signal transduction	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224, 24025841
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	7538907
GO:0009898	Component	Cytoplasmic side of plasma membrane	IC	8565075
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	8565075, 16762833
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031264	Component	Death-inducing signaling complex	TAS	18309324
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	20935634
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16127453
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16127453
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IPI	21109225
GO:0032991	Component	Protein-containing complex	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0035877	Function	Death effector domain binding	IPI	11717445
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	ISS
GO:0042220	Process	Response to cocaine	IEA
GO:0042802	Function	Identical protein binding	IPI	7536190, 8681376, 25502805, 30561431, 31515488, 32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043029	Process	T cell homeostasis	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11821383
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20935634
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IBA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0051607	Process	Defense response to virus	IMP	21109225
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	21109225
GO:0060544	Process	Regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0070236	Process	Negative regulation of activation-induced cell death of T cells	IEA
GO:0070236	Process	Negative regulation of activation-induced cell death of T cells	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071550	Process	Death-inducing signaling complex assembly	IDA	24025841
GO:0089720	Function	Caspase binding	IBA
GO:0089720	Function	Caspase binding	IDA	24025841
GO:0089720	Function	Caspase binding	IPI	9343261
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	8565075, 11101870
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	18309324
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0097527	Process	Necroptotic signaling pathway	IMP	11101870
GO:0098542	Process	Defense response to other organism	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:2000454	Process	Positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	IEA
GO:2000454	Process	Positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013

MIM	HGNC	e!Ensembl
602457	3573	ENSG00000168040

Q13158

Protein name

FAS-associated death domain protein (FAS-associating death domain-containing protein) (Growth-inhibiting gene 3 protein) (Mediator of receptor induced toxicity)

Protein function

Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors (PubMed:16762833, PubMed:19118384, PubMed:20935634, PubMed:23955153, PubMed:24025841, PubMed:7538907, PubMed:9184224). The r

PDB

1A1W , 1A1Z , 1E3Y , 1E41 , 2GF5 , 3EZQ , 3OQ9 , 6ACI , 7LXC , 8YBX , 8YD7 , 8YD8 , 8YNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	4 → 85	Death effector domain	Domain
PF00531	Death	98 → 181	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes. {ECO:0000269|PubMed:7538907}.

Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS

Sequence length

208

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
FADD-related immunodeficiency	Pathogenic; Likely pathogenic	rs863224871, rs387906839	RCV001795381 RCV001787029	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FADD-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 90 WITH ENCEPHALOPATHY, FUNCTIONAL HYPOSPLENIA, AND HEPATIC DYSFUNCTION	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOAURICULAR SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOOTODENTAL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (75)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	16109772, 35029906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Associate	28883894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	39396083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Associate	35480868	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	10817565	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Inhibit	16951485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Associate	10200300, 33995372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	16450001, 18840411, 24886289, 27013580, 27388253, 31443698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	10477698, 21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	27013580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Associate	24886289	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	37666920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Stimulate	17187659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Associate	27078887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	33104018, 35909476	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	36138066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	37798313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	27622714, 28061540, 33076720	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	11279061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	10075697, 16450001, 21135115, 24651037, 31830245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Stimulate	17187659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	19728877	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	23974629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	37798313	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	30344003, 30653393	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	15078899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	11334117	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	24037645	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin Beck Disease	Associate	31762289	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	22208968	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	11514566, 12506034, 35637951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Large Granular Lymphocytic	Associate	17993614	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	11739185, 37367830	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	23096115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	33104018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	37864090	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	19644848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	18268491, 27388253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	23358467, 23974629, 27764170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	10468853, 15009062, 21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Associate	21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	11468180, 21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	9375749	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development Group I	Associate	26025363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	19479204, 23974629, 35421271	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	21315423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	15677568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	16450001	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10075697, 11279061, 12529427, 15991280, 16109772, 16450001, 17203870, 21315423, 26009898, 27013580, 27764170, 29757984, 33133307, 38002938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	36499482	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	36499482	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	19176810, 27832104	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Inhibit	19176810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	31762289	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	28504421	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	14583775, 32504778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pharyngeal Neoplasms	Associate	27764170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35637951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Immunodeficiency Diseases	Associate	38644452	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Associate	17203870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	17203870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	17187659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	17643097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Associate	30551620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	17026852, 23358467, 24278325, 26914121, 27764170, 32065407, 33227411, 33456497, 34423028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	12439910, 15991280	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tarlov Cysts	Associate	24886289	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	27388253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Associate	17643097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	35631261, 37093683	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Associate	32887662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	30567904	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	15197583, 30567904	★★★★★ ★☆☆☆☆ Found in Text Mining only

FADD (Fas associated via death domain)