Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1958
Gene name Gene Name - the full gene name approved by the HGNC.
Early growth response 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EGR1
Synonyms (NCBI Gene) Gene synonyms aliases
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZIF268, ZNF225
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004130 hsa-miR-192-5p Microarray 16822819
MIRT006540 hsa-miR-183-5p Luciferase reporter assay 21118966
MIRT006540 hsa-miR-183-5p Luciferase reporter assay 21118966
MIRT023192 hsa-miR-124-3p Microarray 18668037
MIRT024271 hsa-miR-215-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
ATF5 Unknown 19531563
BRCA1 Unknown 20103632
ETS1 Activation 19074849
ETS1 Unknown 9207063
ETS2 Unknown 9207063
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 19307576
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 18718911
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 14979875, 19307576
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
128990 3238 ENSG00000120738
Protein
UniProt ID P18146
Protein name Early growth response protein 1 (EGR-1) (AT225) (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24)
Protein function Transcriptional regulator (PubMed:20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylatio
PDB 4R2A , 4R2C , 4R2D , 4X9J , 5N14
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11928 DUF3446 135 219 Early growth response N-terminal domain Domain
PF00096 zf-C2H2 338 362 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 368 390 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 396 418 Zinc finger, C2H2 type Domain
PF11914 DUF3432 424 462 Domain of unknown function (DUF3432) Repeat
PF11914 DUF3432 452 530 Domain of unknown function (DUF3432) Repeat
Tissue specificity TISSUE SPECIFICITY: Detected in neutrophils (at protein level). {ECO:0000269|PubMed:20363028}.
Sequence
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPE
PQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSD
MTATFSPRTI
EIC
Sequence length 543
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Stimulate 24376510
Adenocarcinoma Associate 20543560
Adenocarcinoma of Lung Associate 31698633
Alzheimer Disease Associate 15743889, 20405009, 33920138
Anemia Diamond Blackfan Associate 29745857
Anemia Sickle Cell Associate 17156400
Anodontia Stimulate 26134032
Aortic Valve Stenosis Associate 39766890
Arthritis Psoriatic Stimulate 12507899
Arthritis Rheumatoid Associate 15142264, 36238290