Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	91319
Gene name Gene Name - the full gene name approved by the HGNC.	Derlin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DERL3
Synonyms (NCBI Gene) Gene synonyms aliases	C22orf14, IZP6, LLN2, derlin-3
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments
MIRT933231	hsa-miR-1207-3p	CLIP-seq
MIRT933232	hsa-miR-1252	CLIP-seq
MIRT933233	hsa-miR-1257	CLIP-seq
MIRT933234	hsa-miR-1273f	CLIP-seq
MIRT933235	hsa-miR-143	CLIP-seq
MIRT933236	hsa-miR-1825	CLIP-seq
MIRT933237	hsa-miR-2110	CLIP-seq
MIRT933238	hsa-miR-3123	CLIP-seq
MIRT933239	hsa-miR-3202	CLIP-seq
MIRT933240	hsa-miR-3675-5p	CLIP-seq
MIRT933241	hsa-miR-3914	CLIP-seq
MIRT933242	hsa-miR-4271	CLIP-seq
MIRT933243	hsa-miR-4283	CLIP-seq
MIRT933244	hsa-miR-4447	CLIP-seq
MIRT933245	hsa-miR-4472	CLIP-seq
MIRT933246	hsa-miR-4489	CLIP-seq
MIRT933247	hsa-miR-4494	CLIP-seq
MIRT933248	hsa-miR-4525	CLIP-seq
MIRT933249	hsa-miR-4533	CLIP-seq
MIRT933250	hsa-miR-4676-5p	CLIP-seq
MIRT933251	hsa-miR-4708-5p	CLIP-seq
MIRT933252	hsa-miR-4709-3p	CLIP-seq
MIRT933253	hsa-miR-4715-3p	CLIP-seq
MIRT933254	hsa-miR-4724-5p	CLIP-seq
MIRT933255	hsa-miR-4725-3p	CLIP-seq
MIRT933256	hsa-miR-4770	CLIP-seq
MIRT933257	hsa-miR-4786-3p	CLIP-seq
MIRT933258	hsa-miR-4790-3p	CLIP-seq
MIRT933259	hsa-miR-512-3p	CLIP-seq
MIRT933260	hsa-miR-575	CLIP-seq
MIRT933261	hsa-miR-637	CLIP-seq
MIRT933262	hsa-miR-658	CLIP-seq
MIRT933263	hsa-miR-671-5p	CLIP-seq
MIRT933264	hsa-miR-2117	CLIP-seq
MIRT933265	hsa-miR-4273	CLIP-seq
MIRT2515479	hsa-miR-146b-3p	CLIP-seq
MIRT2515480	hsa-miR-1827	CLIP-seq
MIRT2515481	hsa-miR-4316	CLIP-seq
MIRT2515482	hsa-miR-4530	CLIP-seq
MIRT2515483	hsa-miR-4690-3p	CLIP-seq
MIRT2515484	hsa-miR-4699-5p	CLIP-seq
MIRT2515485	hsa-miR-4710	CLIP-seq
MIRT2515486	hsa-miR-488	CLIP-seq
MIRT2515482	hsa-miR-4530	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IBA	21873635
GO:0005047	Function	Signal recognition particle binding	IDA	26565908
GO:0005515	Function	Protein binding	IPI	16449189, 19135427, 32296183
GO:0018279	Process	Protein N-linked glycosylation via asparagine	IMP	22607976
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IBA	21873635
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	IDA	16449189
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IBA	21873635
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IMP	22607976
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	NAS	16449189
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	TAS	22013210
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA	21873635
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	16449189
GO:0044877	Function	Protein-containing complex binding	IPI	26565908
GO:0051787	Function	Misfolded protein binding	IBA	21873635
GO:1904153	Process	Negative regulation of retrograde protein transport, ER to cytosol	IMP	25660456
GO:1990381	Function	Ubiquitin-specific protease binding	IBA	21873635

MIM	HGNC	e!Ensembl
610305	14236	ENSG00000099958

Protein

UniProt ID

Q96Q80

Protein name

Derlin-3 (Degradation in endoplasmic reticulum protein 3) (DERtrin-3) (Der1-like protein 3)

Protein function

Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoprotei

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04511	DER1	13 → 203	Der1-like family	Family

Tissue specificity

TISSUE SPECIFICITY: Unlike DERL1 and DERL2, restricted to several tissues. Expressed at high levels in placenta, pancreas, spleen and small intestine. {ECO:0000269|PubMed:16449189}.

Sequence

MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ

Sequence length

235

Interactions

View interactions

DERL3 (derlin 3)