DEFB1 (defensin beta 1)

Gene

• Entrez ID: 1672
• Gene name: Defensin beta 1
• Gene symbol: DEFB1
• Synonyms (NCBI Gene): BD1, DEFB-1, DEFB101, HBD1
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT755820	hsa-miR-186-5p	Western blotting, qRT-PCR	36678471
MIRT755821	hsa-miR-340-5p	Western blotting, qRT-PCR	36678471
MIRT931952	hsa-miR-3163	CLIP-seq
MIRT931953	hsa-miR-340	CLIP-seq
MIRT931954	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Unknown	23185513

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002227	Process	Innate immune response in mucosa	IBA
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0005515	Function	Protein binding	IPI	25122636, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	7628632, 12860195, 21115716
GO:0005615	Component	Extracellular space	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006935	Process	Chemotaxis	TAS	10521347
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	TAS	10521347
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10521347
GO:0009617	Process	Response to bacterium	IDA	12054642
GO:0009617	Process	Response to bacterium	ISS
GO:0016020	Component	Membrane	IDA	23938203
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	25122636
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0031731	Function	CCR6 chemokine receptor binding	IBA
GO:0031731	Function	CCR6 chemokine receptor binding	IDA	25122636
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IMP	21115716
GO:0042802	Function	Identical protein binding	IDA	23938203
GO:0045087	Process	Innate immune response	ISS
GO:0045087	Process	Innate immune response	NAS	12517831
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	25122636
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	25122636
GO:0060474	Process	Positive regulation of flagellated sperm motility involved in capacitation	IMP	25122636
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	25122636
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097225	Component	Sperm midpiece	IDA	25122636
GO:0140546	Process	Defense response to symbiont	IEA
GO:1990742	Component	Microvesicle	IDA	23938203

Other IDs

• MIM: 602056
• HGNC: 2766
• e!Ensembl: ENSG00000164825

Protein

• UniProt ID: P60022
• Protein name: Beta-defensin 1 (BD-1) (hBD-1) (Defensin, beta 1)
• Protein function: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is impo
• PDB: 1E4S, 1IJU, 1IJV, 1KJ5, 2NLB, 2NLC, 2NLD, 2NLE, 2NLF, 2NLG, 2NLH, 2NLP, 2NLQ, 2NLS, 2PLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00711	Defensin_beta	33 → 68	Beta defensin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level). {ECO:0000269|PubMed:25122636, ECO:00
• Sequence:

  MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
  RGKAKCCK

• Sequence length: 68