Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8528
Gene name Gene Name - the full gene name approved by the HGNC.	D-aspartate oxidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DDO
Synonyms (NCBI Gene) Gene synonyms aliases	DASOX, DASPO, DDO-1, DDO-2
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT663082	hsa-miR-6750-3p	HITS-CLIP	23824327
MIRT663081	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT663080	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT663079	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT663078	hsa-miR-5701	HITS-CLIP	23824327
MIRT663082	hsa-miR-6750-3p	HITS-CLIP	23824327
MIRT663081	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT663080	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT663079	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT663078	hsa-miR-5701	HITS-CLIP	23824327
MIRT929418	hsa-miR-3199	CLIP-seq
MIRT929419	hsa-miR-4715-3p	CLIP-seq
MIRT2210574	hsa-miR-4698	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003884	Function	D-amino-acid oxidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	9820813
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005777	Component	Peroxisome	NAS	9820813
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006533	Process	Aspartate catabolic process	IBA	21873635
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007320	Process	Insemination	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0008445	Function	D-aspartate oxidase activity	IBA	21873635
GO:0008445	Function	D-aspartate oxidase activity	IDA	20603179
GO:0019478	Process	D-amino acid catabolic process	IBA	21873635
GO:0019478	Process	D-amino acid catabolic process	IDA	20603179
GO:0034641	Process	Cellular nitrogen compound metabolic process	TAS
GO:0042445	Process	Hormone metabolic process	IEA
GO:0071949	Function	FAD binding	IDA	20603179

MIM	HGNC	e!Ensembl
124450	2727	ENSG00000203797

Protein

UniProt ID

Q99489

Protein name

D-aspartate oxidase (DASOX) (DASPO) (DDO) (EC 1.4.3.1)

Protein function

Selectively catalyzes the oxidative deamination of acidic amino acids (PubMed:1991137, PubMed:20603179, PubMed:23391306, PubMed:25747990, PubMed:28393897, PubMed:28560262, PubMed:28629864, PubMed:29292239, PubMed:31914658, PubMed:32553892, PubMe

PDB

6RKF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01266	DAO	5 → 324	FAD dependent oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in epithelial cells of the proximal nephron tubules in the renal cortex (at protein level) (PubMed:12209855, PubMed:1991137). In the brain, expressed in the frontal, temporal, and occipital lobes of the cortex, hippocampus, s

Sequence

MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMT
EAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKG
DWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL

Sequence length

341

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining
Dermatitis Atopic 3	Associate	29729188

DDO (D-aspartate oxidase)