Gene Gene information from NCBI Gene database.
Entrez ID 2921
Gene name C-X-C motif chemokine ligand 3
Gene symbol CXCL3
Synonyms (NCBI Gene)
CINC-2bGRO3GROgMIP-2bMIP2BSCYB3
Chromosome 4
Chromosome location 4q13.3
Summary This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra
miRNA miRNA information provided by mirtarbase database.
114
miRTarBase ID miRNA Experiments Reference
MIRT005823 hsa-miR-204-5p Microarray 21282569
MIRT018278 hsa-miR-335-5p Microarray 18185580
MIRT023824 hsa-miR-1-3p Microarray 18668037
MIRT711194 hsa-miR-100-3p HITS-CLIP 19536157
MIRT711193 hsa-miR-3161 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IDA 10095777
GO:0005615 Component Extracellular space IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
139111 4604 ENSG00000163734
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19876
Protein name C-X-C motif chemokine 3 (GRO-gamma(1-73)) (Growth-regulated protein gamma) (GRO-gamma) (Macrophage inflammatory protein 2-beta) (MIP2-beta) [Cleaved into: GRO-gamma(5-73)]
Protein function Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher
PDB 8XWF , 8XX3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 41 100 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKI
LNKGSTN
Sequence length 107
Interactions View interactions