Gene Gene information from NCBI Gene database.
Entrez ID 2920
Gene name C-X-C motif chemokine ligand 2
Gene symbol CXCL2
Synonyms (NCBI Gene)
CINC-2aGRO2GRObMGSA-bMIP-2aMIP2MIP2ASCYB2
Chromosome 4
Chromosome location 4q13.3
Summary This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residue
miRNA miRNA information provided by mirtarbase database.
167
miRTarBase ID miRNA Experiments Reference
MIRT018317 hsa-miR-335-5p Microarray 18185580
MIRT023893 hsa-miR-1-3p Microarray 18668037
MIRT027726 hsa-miR-98-5p Microarray 19088304
MIRT438285 hsa-miR-223-3p Luciferase reporter assay 24084739
MIRT438285 hsa-miR-223-3p Luciferase reporter assay 24084739
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Unknown 17363596
RELA Unknown 17363596
SMAD1 Unknown 17363596
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0002237 Process Response to molecule of bacterial origin IDA 19912257
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 18275857, 21314817, 28381538
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
139110 4603 ENSG00000081041
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19875
Protein name C-X-C motif chemokine 2 (Growth-regulated protein beta) (Gro-beta) (Macrophage inflammatory protein 2-alpha) (MIP2-alpha) [Cleaved into: GRO-beta(5-73) (GRO-beta-T) (Hematopoietic synergistic factor) (HSF) (SB-251353)]
Protein function Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic act
PDB 1QNK , 5OB5 , 8XVU , 8XXH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 41 100 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM
LKNGKSN
Sequence length 107
Interactions View interactions