CSPG5 (chondroitin sulfate proteoglycan 5)

Gene

• Entrez ID: 10675
• Gene name: Chondroitin sulfate proteoglycan 5
• Gene symbol: CSPG5
• Synonyms (NCBI Gene): NGC
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029790	hsa-miR-26b-5p	Microarray	19088304
MIRT049719	hsa-miR-92a-3p	CLASH	23622248
MIRT052881	hsa-miR-3691-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	12885772
GO:0005576	Component	Extracellular region	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	12885772
GO:0005796	Component	Golgi lumen	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9950058
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007399	Process	Nervous system development	TAS	12885772
GO:0008083	Function	Growth factor activity	TAS	12885772
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	TAS	9950058
GO:0016021	Component	Integral component of membrane	TAS	12885772
GO:0030206	Process	Chondroitin sulfate biosynthetic process	TAS
GO:0030207	Process	Chondroitin sulfate catabolic process	TAS
GO:0030208	Process	Dermatan sulfate biosynthetic process	TAS
GO:0030660	Component	Golgi-associated vesicle membrane	IDA	12885772
GO:0040008	Process	Regulation of growth	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA	21873635
GO:0046907	Process	Intracellular transport	TAS	12885772
GO:0048858	Process	Cell projection morphogenesis	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099550	Process	Trans-synaptic signaling, modulating synaptic transmission	IBA	21873635
GO:0106091	Process	Glial cell projection elongation	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	ISS
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

Other IDs

• MIM: 606775
• HGNC: 2467
• e!Ensembl: ENSG00000114646

Protein

• UniProt ID: O95196
• Protein name: Chondroitin sulfate proteoglycan 5 (Acidic leucine-rich EGF-like domain-containing brain protein) (Neuroglycan C)
• Protein function: May function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06566	Chon_Sulph_att	33 → 277	Chondroitin sulphate attachment domain	Domain
  PF06567	Neural_ProG_Cyt	447 → 565	Neural chondroitin sulphate proteoglycan cytoplasmic domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). Expressed in brain (at protein level) (PubMed:9950058). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:3745
• Sequence:

  MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTR
  EEAGPPAAGEDEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDA
  QALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLG
  GSTPDPQGPELTYPFQGTLEPQPASDIIDIDYFEGLDGEGRGADLGSFPGSPGTSENHPD
  TEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEEEEEDDKDAVGGGDLEDENEL
  LVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECR
  SGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQ
  VMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIA
  EGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQN
  SMSPKLEGGKGDQADLDVNCLQNNLT

• Sequence length: 566