Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1459
Gene name Gene Name - the full gene name approved by the HGNC.	Casein kinase 2 alpha 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSNK2A2
Synonyms (NCBI Gene) Gene synonyms aliases	CK2A2, CK2alpha', CSNK2A1
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the alpha`, or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular pr

Show/Hide all(62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024100	hsa-miR-1-3p	Proteomics	18668040
MIRT053052	hsa-miR-1228-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23554909
MIRT053052	hsa-miR-1228-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23554909
MIRT912875	hsa-miR-1289	CLIP-seq
MIRT912876	hsa-miR-3185	CLIP-seq
MIRT912877	hsa-miR-3198	CLIP-seq
MIRT912878	hsa-miR-421	CLIP-seq
MIRT912879	hsa-miR-4294	CLIP-seq
MIRT912880	hsa-miR-4309	CLIP-seq
MIRT912881	hsa-miR-4318	CLIP-seq
MIRT912882	hsa-miR-4709-5p	CLIP-seq
MIRT912883	hsa-miR-4786-3p	CLIP-seq
MIRT912884	hsa-miR-505	CLIP-seq
MIRT912885	hsa-miR-671-5p	CLIP-seq
MIRT2206520	hsa-miR-3160-5p	CLIP-seq
MIRT2206521	hsa-miR-4314	CLIP-seq
MIRT2206522	hsa-miR-544	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2678716	hsa-miR-4796-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2678717	hsa-miR-548t	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2678718	hsa-miR-589	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000785	Component	Chromatin	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20545769, 21482717, 22325354, 30898438, 35597237
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IGI	28031292
GO:0005515	Function	Protein binding	IPI	10094392, 11972058, 14667819, 19011756, 21988832, 23455922, 23555304, 25416956, 25519132, 25852190, 26496610, 27705803, 28031292, 28514442, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005956	Component	Protein kinase CK2 complex	IBA
GO:0005956	Component	Protein kinase CK2 complex	ISS
GO:0006302	Process	Double-strand break repair	IDA	22325354
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IGI	28031292
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1905818	Process	Regulation of chromosome separation	IBA
GO:1905818	Process	Regulation of chromosome separation	IMP	11704824
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	TAS	28031292

MIM	HGNC	e!Ensembl
115442	2459	ENSG00000070770

Protein

UniProt ID

P19784

Protein name

Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)

Protein function

Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (PubMed:11239457, PubMed:117048

PDB

3E3B , 3OFM , 3U87 , 5M4U , 5M56 , 5OOI , 5Y9M , 5YF9 , 5YWM , 6HMB , 6HMC , 6HMD , 6HMQ , 6L20 , 6QY8 , 6QY9 , 6TE2 , 6TEW , 6TGU , 7A1B , 7A1Z , 7A22 , 7A2H , 7AT9 , 7ATV , 7XYH , 8Q77 , 8Q9S , 8QBU , 8QCD , 8QCG , 8QF1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	40 → 325	Protein kinase domain	Domain

Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Sequence length

350

Interactions

View interactions

CSNK2A2 (casein kinase 2 alpha 2)