Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	1459
Gene name	Casein kinase 2 alpha 2
Gene symbol	CSNK2A2
Synonyms (NCBI Gene)	CK2A2CK2alpha'CSNK2A1
Chromosome	16
Chromosome location	16q21
Summary	This gene encodes the alpha`, or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular pr

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024100	hsa-miR-1-3p	Proteomics	18668040
MIRT053052	hsa-miR-1228-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23554909
MIRT053052	hsa-miR-1228-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23554909
MIRT912875	hsa-miR-1289	CLIP-seq
MIRT912876	hsa-miR-3185	CLIP-seq
MIRT912877	hsa-miR-3198	CLIP-seq
MIRT912878	hsa-miR-421	CLIP-seq
MIRT912879	hsa-miR-4294	CLIP-seq
MIRT912880	hsa-miR-4309	CLIP-seq
MIRT912881	hsa-miR-4318	CLIP-seq
MIRT912882	hsa-miR-4709-5p	CLIP-seq
MIRT912883	hsa-miR-4786-3p	CLIP-seq
MIRT912884	hsa-miR-505	CLIP-seq
MIRT912885	hsa-miR-671-5p	CLIP-seq
MIRT2206520	hsa-miR-3160-5p	CLIP-seq
MIRT2206521	hsa-miR-4314	CLIP-seq
MIRT2206522	hsa-miR-544	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq
MIRT2509773	hsa-miR-1178	CLIP-seq
MIRT2509774	hsa-miR-1284	CLIP-seq
MIRT2509775	hsa-miR-208a	CLIP-seq
MIRT2509776	hsa-miR-208b	CLIP-seq
MIRT2509777	hsa-miR-2113	CLIP-seq
MIRT2509778	hsa-miR-3148	CLIP-seq
MIRT2509779	hsa-miR-346	CLIP-seq
MIRT2509780	hsa-miR-3688-3p	CLIP-seq
MIRT2509781	hsa-miR-4273	CLIP-seq
MIRT2509782	hsa-miR-4288	CLIP-seq
MIRT2509783	hsa-miR-4677-5p	CLIP-seq
MIRT2509784	hsa-miR-4695-3p	CLIP-seq
MIRT2509785	hsa-miR-4711-3p	CLIP-seq
MIRT2509786	hsa-miR-4715-3p	CLIP-seq
MIRT2678716	hsa-miR-4796-3p	CLIP-seq
MIRT2509787	hsa-miR-499-5p	CLIP-seq
MIRT2678717	hsa-miR-548t	CLIP-seq
MIRT2509788	hsa-miR-578	CLIP-seq
MIRT2678718	hsa-miR-589	CLIP-seq
MIRT2509789	hsa-miR-592	CLIP-seq
MIRT2509790	hsa-miR-599	CLIP-seq
MIRT2509791	hsa-miR-632	CLIP-seq
MIRT2509792	hsa-miR-659	CLIP-seq
MIRT2509793	hsa-miR-767-3p	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000785	Component	Chromatin	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20545769, 21482717, 22325354, 30898438, 35597237
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IGI	28031292
GO:0005515	Function	Protein binding	IPI	10094392, 11972058, 14667819, 19011756, 21988832, 23455922, 23555304, 25416956, 25519132, 25852190, 26496610, 27705803, 28031292, 28514442, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005956	Component	Protein kinase CK2 complex	IBA
GO:0005956	Component	Protein kinase CK2 complex	ISS
GO:0006302	Process	Double-strand break repair	IDA	22325354
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IGI	28031292
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1905818	Process	Regulation of chromosome separation	IBA
GO:1905818	Process	Regulation of chromosome separation	IMP	11704824
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	TAS	28031292

MIM	HGNC	e!Ensembl
115442	2459	ENSG00000070770

P19784

Protein name

Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)

Protein function

Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (PubMed:11239457, PubMed:117048

PDB

3E3B , 3OFM , 3U87 , 5M4U , 5M56 , 5OOI , 5Y9M , 5YF9 , 5YWM , 6HMB , 6HMC , 6HMD , 6HMQ , 6L20 , 6QY8 , 6QY9 , 6TE2 , 6TEW , 6TGU , 7A1B , 7A1Z , 7A22 , 7A2H , 7AT9 , 7ATV , 7XYH , 8Q77 , 8Q9S , 8QBU , 8QCD , 8QCG , 8QF1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	40 → 325	Protein kinase domain	Domain

Sequence

MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Sequence length

350

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	Benign	rs58415199	RCV005915747
CSNK2A2-related disorder	Uncertain significance	rs2543563904	RCV003904614
Malignant lymphoma, large B-cell, diffuse	Benign	rs58415199	RCV005915745
Uterine carcinosarcoma	Benign	rs58415199	RCV005915746
Uterine corpus endometrial carcinoma	Benign	rs74019837	RCV005921505
Uveal melanoma	Benign	rs58415199	RCV005915744

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Follicular	Stimulate	25227853
Adenocarcinoma of Lung	Associate	36769342
Adenoma Oxyphilic	Associate	28975890
Aortic Aneurysm Abdominal	Associate	29439675
Breast Neoplasms	Associate	24098452, 26703694, 27746184, 33164285
Burkitt Lymphoma	Associate	25788269
Calcinosis Cutis	Associate	28975890
Carcinogenesis	Associate	24616922, 31406250
Carcinoma	Stimulate	25227853
Carcinoma Ductal Breast	Associate	33164285
Carcinoma Hepatocellular	Associate	24616922
Carcinoma Medullary	Stimulate	25227853
Carcinoma Non Small Cell Lung	Associate	23188828
Carcinoma Ovarian Epithelial	Associate	28355289
Carcinoma Papillary	Stimulate	25227853
Carcinoma Renal Cell	Stimulate	27906674
Carcinoma Renal Cell	Associate	28975890
Colorectal Neoplasms	Associate	19098285, 21359197, 21702981, 36333388
Developmental Disabilities	Associate	40317201
Diabetes Mellitus Type 2	Associate	32296102
Diabetic Cardiomyopathies	Associate	34418601
Esophageal Neoplasms	Associate	22675025
Hereditary Breast and Ovarian Cancer Syndrome	Associate	24098452, 25541719
Intellectual Disability	Associate	40317201
Leukemia Lymphocytic Chronic B Cell	Associate	36271116
Leukemia Myeloid Acute	Associate	24283803
Lung Neoplasms	Associate	22768056, 23651443
Lymphatic Metastasis	Stimulate	25227853
Lymphatic Metastasis	Associate	33164285
Lymphoma B Cell	Associate	22106042
Medulloblastoma	Associate	31406250
Melanoma	Associate	27226552, 27251789
Mesothelioma	Associate	25422081
Mesothelioma Malignant	Associate	25422081
Mitochondrial Diseases	Associate	34418601
Multiple Trauma	Associate	31713447
Necrosis	Inhibit	20718998
Neoplasms	Associate	21702981, 24616922, 25541719, 26703694, 27226552, 27906674, 28270146, 28355289, 31406250, 31713447, 33164285, 34359939
Neoplasms	Stimulate	24098452
Neuroblastoma	Associate	27164076, 27251789
Obesity	Associate	35470975
Ovarian Neoplasms	Associate	28270146
Ovarian Neoplasms	Stimulate	28355289
Pancreatic Neoplasms	Associate	20718998
Prostatic Hyperplasia	Associate	27435858
Prostatic Neoplasms	Associate	27435858
Squamous Cell Carcinoma of Head and Neck	Associate	16818647
Teratozoospermia	Associate	20562896
Thyroid Cancer Papillary	Associate	25227853
Thyroid Diseases	Associate	25227853
Thyroid Neoplasms	Stimulate	25227853
Urinary Bladder Neoplasms	Associate	40594996

CSNK2A2 (casein kinase 2 alpha 2)