Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1390
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP responsive element modulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CREM
Synonyms (NCBI Gene) Gene synonyms aliases	CREM-2, ICER, hCREM-2
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple

Show/Hide all(115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT909498	hsa-miR-3606	CLIP-seq
MIRT909499	hsa-miR-494	CLIP-seq
MIRT909500	hsa-miR-570	CLIP-seq
MIRT909501	hsa-let-7a	CLIP-seq
MIRT909502	hsa-let-7b	CLIP-seq
MIRT909503	hsa-let-7c	CLIP-seq
MIRT909504	hsa-let-7d	CLIP-seq
MIRT909505	hsa-let-7e	CLIP-seq
MIRT909506	hsa-let-7f	CLIP-seq
MIRT909507	hsa-let-7g	CLIP-seq
MIRT909508	hsa-let-7i	CLIP-seq
MIRT909509	hsa-miR-1	CLIP-seq
MIRT909510	hsa-miR-1200	CLIP-seq
MIRT909511	hsa-miR-129-5p	CLIP-seq
MIRT909512	hsa-miR-202	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT909514	hsa-miR-206	CLIP-seq
MIRT909515	hsa-miR-2113	CLIP-seq
MIRT909516	hsa-miR-3074-5p	CLIP-seq
MIRT909517	hsa-miR-3124-3p	CLIP-seq
MIRT909518	hsa-miR-4324	CLIP-seq
MIRT909519	hsa-miR-4458	CLIP-seq
MIRT909520	hsa-miR-4500	CLIP-seq
MIRT909521	hsa-miR-4678	CLIP-seq
MIRT909522	hsa-miR-544b	CLIP-seq
MIRT909523	hsa-miR-613	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT909525	hsa-miR-651	CLIP-seq
MIRT909526	hsa-miR-98	CLIP-seq
MIRT1969583	hsa-miR-1273g	CLIP-seq
MIRT1969584	hsa-miR-25	CLIP-seq
MIRT1969585	hsa-miR-32	CLIP-seq
MIRT1969586	hsa-miR-363	CLIP-seq
MIRT1969587	hsa-miR-367	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT1969590	hsa-miR-92a	CLIP-seq
MIRT1969591	hsa-miR-92b	CLIP-seq
MIRT2205731	hsa-miR-548ae	CLIP-seq
MIRT2205732	hsa-miR-548aj	CLIP-seq
MIRT2205733	hsa-miR-548am	CLIP-seq
MIRT2205734	hsa-miR-548x	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508798	hsa-miR-2276	CLIP-seq
MIRT2508799	hsa-miR-299-3p	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508801	hsa-miR-3688-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508804	hsa-miR-376c	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508808	hsa-miR-4300	CLIP-seq
MIRT2508809	hsa-miR-4491	CLIP-seq
MIRT2508810	hsa-miR-4657	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT2508812	hsa-miR-4789-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT2508813	hsa-miR-558	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT2508814	hsa-miR-642b	CLIP-seq
MIRT2508815	hsa-miR-920	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
FOS	Activation	21757709
JUN	Activation	21757709
SP1	Activation	21757709

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12626549
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16899810
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	12626549
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	7916662
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10373550, 21976679, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8206879
GO:0005634	Component	Nucleus	TAS	7916662
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	8206879
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	7916662
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006687	Process	Glycosphingolipid metabolic process	IEA
GO:0007165	Process	Signal transduction	TAS	7916662
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008140	Function	CAMP response element binding protein binding	NAS	8206879
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0141156	Process	CAMP/PKA signal transduction	IBA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
123812	2352	ENSG00000095794

Protein

UniProt ID

Q03060

Protein name

cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)

Protein function

Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02173	pKID	98 → 140	pKID domain	Family
PF00170	bZIP_1	284 → 344	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes. {ECO:0000269|PubMed:11044457, ECO:0000269|PubMed:14511788, ECO:0000269|PubMed:16143638}.

Sequence

MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
YRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

Sequence length

345

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Neoplasms	Associate	34228212
Brain Edema	Associate	32970137
Breast Neoplasms	Associate	27993161
Carcinoma Renal Cell	Associate	34251595, 35165059
Central Nervous System Neoplasms	Associate	28281318
Colitis Ulcerative	Associate	23388545
Cystic Fibrosis	Associate	35315363
Disease	Associate	34261344
Ganglion Cysts	Associate	28281318
Glioma	Associate	36980858
Headache	Associate	32970137
Heart Diseases	Associate	30212560
Hemangioma	Associate	34821426
Histiocytoma Angiomatoid Fibrous	Associate	34821426
HIV Infections	Associate	35041523
Infertility Male	Associate	21507395, 33786731, 9531892
Inflammation	Associate	22531917
Kidney Diseases	Associate	26601115
Lubinsky syndrome	Associate	9531892
Lupus Erythematosus Systemic	Associate	11238674, 12370343, 12626549, 15322221, 16237091, 26601115
Lupus Nephritis	Associate	26601115
Lymphoma T Cell Cutaneous	Associate	36265653
Malignant mesenchymal tumor	Associate	28009602, 28281318, 32970137, 33141488, 34261344, 34715942, 34821426
Meningeal Neoplasms	Associate	28009602
Neoplasms	Stimulate	23388545
Neoplasms	Associate	32770123, 33141488, 34228212, 34261344, 34821426, 35347249, 36083250, 36265653, 36966162, 37097347
Oligospermia	Associate	21507395
Paraganglioma	Associate	36083250
Prostatic Neoplasms	Associate	28072703
Salivary Gland Neoplasms	Associate	34261344
Sarcoma Clear Cell	Associate	30219084, 34228212, 34715942
Soft Tissue Neoplasms	Associate	38460673
Tetralogy of Fallot	Associate	30212560
Venous Thromboembolism	Associate	33388092
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Associate	39796118

CREM (cAMP responsive element modulator)