Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	1390
Gene name	CAMP responsive element modulator
Gene symbol	CREM
Synonyms (NCBI Gene)	CREM-2ICERhCREM-2
Chromosome	10
Chromosome location	10p11.21
Summary	This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple

115

Show/Hide all (115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT439169	hsa-let-7c-5p	3'LIFE	25074381
MIRT688650	hsa-miR-562	HITS-CLIP	23313552
MIRT688649	hsa-miR-4759	HITS-CLIP	23313552
MIRT688648	hsa-miR-3169	HITS-CLIP	23313552
MIRT688647	hsa-miR-8083	HITS-CLIP	23313552
MIRT688646	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT688645	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT688644	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT688643	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT688642	hsa-miR-1976	HITS-CLIP	23313552
MIRT688641	hsa-miR-4312	HITS-CLIP	23313552
MIRT688640	hsa-miR-1288-3p	HITS-CLIP	23313552
MIRT688639	hsa-miR-30a-5p	HITS-CLIP	23313552
MIRT688638	hsa-miR-30b-5p	HITS-CLIP	23313552
MIRT688637	hsa-miR-30c-5p	HITS-CLIP	23313552
MIRT688636	hsa-miR-30d-5p	HITS-CLIP	23313552
MIRT688635	hsa-miR-30e-5p	HITS-CLIP	23313552
MIRT688634	hsa-miR-3117-3p	HITS-CLIP	23313552
MIRT909498	hsa-miR-3606	CLIP-seq
MIRT909499	hsa-miR-494	CLIP-seq
MIRT909500	hsa-miR-570	CLIP-seq
MIRT909501	hsa-let-7a	CLIP-seq
MIRT909502	hsa-let-7b	CLIP-seq
MIRT909503	hsa-let-7c	CLIP-seq
MIRT909504	hsa-let-7d	CLIP-seq
MIRT909505	hsa-let-7e	CLIP-seq
MIRT909506	hsa-let-7f	CLIP-seq
MIRT909507	hsa-let-7g	CLIP-seq
MIRT909508	hsa-let-7i	CLIP-seq
MIRT909509	hsa-miR-1	CLIP-seq
MIRT909510	hsa-miR-1200	CLIP-seq
MIRT909511	hsa-miR-129-5p	CLIP-seq
MIRT909512	hsa-miR-202	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT909514	hsa-miR-206	CLIP-seq
MIRT909515	hsa-miR-2113	CLIP-seq
MIRT909516	hsa-miR-3074-5p	CLIP-seq
MIRT909517	hsa-miR-3124-3p	CLIP-seq
MIRT909518	hsa-miR-4324	CLIP-seq
MIRT909519	hsa-miR-4458	CLIP-seq
MIRT909520	hsa-miR-4500	CLIP-seq
MIRT909521	hsa-miR-4678	CLIP-seq
MIRT909522	hsa-miR-544b	CLIP-seq
MIRT909523	hsa-miR-613	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT909525	hsa-miR-651	CLIP-seq
MIRT909526	hsa-miR-98	CLIP-seq
MIRT1969583	hsa-miR-1273g	CLIP-seq
MIRT1969584	hsa-miR-25	CLIP-seq
MIRT1969585	hsa-miR-32	CLIP-seq
MIRT1969586	hsa-miR-363	CLIP-seq
MIRT1969587	hsa-miR-367	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT1969590	hsa-miR-92a	CLIP-seq
MIRT1969591	hsa-miR-92b	CLIP-seq
MIRT2205731	hsa-miR-548ae	CLIP-seq
MIRT2205732	hsa-miR-548aj	CLIP-seq
MIRT2205733	hsa-miR-548am	CLIP-seq
MIRT2205734	hsa-miR-548x	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508798	hsa-miR-2276	CLIP-seq
MIRT2508799	hsa-miR-299-3p	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508801	hsa-miR-3688-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508804	hsa-miR-376c	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508808	hsa-miR-4300	CLIP-seq
MIRT2508809	hsa-miR-4491	CLIP-seq
MIRT2508810	hsa-miR-4657	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT2508812	hsa-miR-4789-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT2508813	hsa-miR-558	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq
MIRT2508814	hsa-miR-642b	CLIP-seq
MIRT2508815	hsa-miR-920	CLIP-seq
MIRT2508796	hsa-miR-1202	CLIP-seq
MIRT2508797	hsa-miR-1284	CLIP-seq
MIRT909513	hsa-miR-205	CLIP-seq
MIRT2508800	hsa-miR-3194-5p	CLIP-seq
MIRT2508802	hsa-miR-376a	CLIP-seq
MIRT2508803	hsa-miR-376b	CLIP-seq
MIRT2508805	hsa-miR-3972	CLIP-seq
MIRT2508806	hsa-miR-4277	CLIP-seq
MIRT2508807	hsa-miR-4297	CLIP-seq
MIRT2508811	hsa-miR-4786-3p	CLIP-seq
MIRT1969588	hsa-miR-520d-5p	CLIP-seq
MIRT1969589	hsa-miR-524-5p	CLIP-seq
MIRT909524	hsa-miR-630	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
FOS	Activation	21757709
JUN	Activation	21757709
SP1	Activation	21757709

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12626549
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16899810
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	12626549
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	7916662
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10373550, 21976679, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8206879
GO:0005634	Component	Nucleus	TAS	7916662
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	8206879
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	7916662
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006687	Process	Glycosphingolipid metabolic process	IEA
GO:0007165	Process	Signal transduction	TAS	7916662
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008140	Function	CAMP response element binding protein binding	NAS	8206879
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0141156	Process	CAMP/PKA signal transduction	IBA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
123812	2352	ENSG00000095794

Q03060

Protein name

cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)

Protein function

Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02173	pKID	98 → 140	pKID domain	Family
PF00170	bZIP_1	284 → 344	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes. {ECO:0000269|PubMed:11044457, ECO:0000269|PubMed:14511788, ECO:0000269|PubMed:16143638}.

Sequence

MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
YRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY

Sequence length

345

Interactions

View interactions

CREM (cAMP responsive element modulator)