Gene Gene information from NCBI Gene database.
Entrez ID 9586
Gene name CAMP responsive element binding protein 5
Gene symbol CREB5
Synonyms (NCBI Gene)
CRE-BPACREB-5CREBPA
Chromosome 7
Chromosome location 7p15.1-p14.3
Summary The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun o
miRNA miRNA information provided by mirtarbase database.
591
miRTarBase ID miRNA Experiments Reference
MIRT006460 hsa-miR-204-5p ImmunofluorescenceMicroarrayqRT-PCRWestern blot 22523078
MIRT006462 hsa-miR-211-5p ImmunofluorescenceMicroarrayqRT-PCRWestern blot 22523078
MIRT006460 hsa-miR-204-5p ImmunofluorescenceMicroarrayqRT-PCRWestern blot 22523078
MIRT006462 hsa-miR-211-5p ImmunofluorescenceMicroarrayqRT-PCRWestern blot 22523078
MIRT021286 hsa-miR-125a-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IDA 8378084
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618262 16844 ENSG00000146592
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02930
Protein name Cyclic AMP-responsive element-binding protein 5 (CREB-5) (cAMP-responsive element-binding protein 5) (cAMP-response element-binding protein A) (CRE-BPa)
Protein function Binds to the cAMP response element and activates transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 373 436 bZIP transcription factor Coiled-coil
Sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLL
THKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
Sequence length 508
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Vascular endothelial growth factor (VEGF) inhibitor response association rs4722804 RCV002254031
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32755048
Amyotrophic Lateral Sclerosis Associate 31118040
Atherosclerosis Associate 36720950, 40708018
Breast Neoplasms Associate 35662106
Carcinogenesis Associate 35662106
Carcinoma Hepatocellular Associate 36565037, 37996058
Colorectal Neoplasms Stimulate 25076032
Colorectal Neoplasms Associate 29945573, 37816820
Coronavirus Infections Associate 34176764
Depressive Disorder Treatment Resistant Stimulate 36603462