CREB3L4 (cAMP responsive element binding protein 3 like 4)

Gene

• Entrez ID: 148327
• Gene name: CAMP responsive element binding protein 3 like 4
• Gene symbol: CREB3L4
• Synonyms (NCBI Gene): AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT908896	hsa-let-7a	CLIP-seq
MIRT908897	hsa-let-7b	CLIP-seq
MIRT908898	hsa-let-7c	CLIP-seq
MIRT908899	hsa-let-7d	CLIP-seq
MIRT908900	hsa-let-7e	CLIP-seq
MIRT908901	hsa-let-7f	CLIP-seq
MIRT908902	hsa-let-7g	CLIP-seq
MIRT908903	hsa-let-7i	CLIP-seq
MIRT908904	hsa-miR-1229	CLIP-seq
MIRT908905	hsa-miR-1304	CLIP-seq
MIRT908906	hsa-miR-1323	CLIP-seq
MIRT908907	hsa-miR-202	CLIP-seq
MIRT908908	hsa-miR-3679-3p	CLIP-seq
MIRT908909	hsa-miR-371b-5p	CLIP-seq
MIRT908910	hsa-miR-4458	CLIP-seq
MIRT908911	hsa-miR-4500	CLIP-seq
MIRT908912	hsa-miR-548ad	CLIP-seq
MIRT908913	hsa-miR-548o	CLIP-seq
MIRT908914	hsa-miR-888	CLIP-seq
MIRT908915	hsa-miR-98	CLIP-seq
MIRT2205510	hsa-miR-125a-5p	CLIP-seq
MIRT2205511	hsa-miR-125b	CLIP-seq
MIRT2205512	hsa-miR-3163	CLIP-seq
MIRT2205513	hsa-miR-3166	CLIP-seq
MIRT2205514	hsa-miR-3616-3p	CLIP-seq
MIRT2205515	hsa-miR-4269	CLIP-seq
MIRT2205516	hsa-miR-4319	CLIP-seq
MIRT2205517	hsa-miR-4436b-3p	CLIP-seq
MIRT2205518	hsa-miR-4509	CLIP-seq
MIRT2205519	hsa-miR-4514	CLIP-seq
MIRT2205520	hsa-miR-4520b-3p	CLIP-seq
MIRT2205521	hsa-miR-4529-3p	CLIP-seq
MIRT2205522	hsa-miR-4535	CLIP-seq
MIRT2205523	hsa-miR-4668-3p	CLIP-seq
MIRT2205524	hsa-miR-4692	CLIP-seq
MIRT2205525	hsa-miR-4721	CLIP-seq
MIRT2205526	hsa-miR-4742-5p	CLIP-seq
MIRT2205527	hsa-miR-4747-5p	CLIP-seq
MIRT2205528	hsa-miR-4776-5p	CLIP-seq
MIRT2205529	hsa-miR-544b	CLIP-seq
MIRT2205530	hsa-miR-562	CLIP-seq
MIRT2205531	hsa-miR-711	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16236796
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035497	Function	CAMP response element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16236796
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607138
• HGNC: 18854
• e!Ensembl: ENSG00000143578

Protein

• UniProt ID: Q8TEY5
• Protein name: Cyclic AMP-responsive element-binding protein 3-like protein 4 (cAMP-responsive element-binding protein 3-like protein 4) (Androgen-induced basic leucine zipper protein) (AIbZIP) (Attaching to CRE-like 1) (ATCE1) (Cyclic AMP-responsive element-binding pro
• Protein function: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional acti
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	215 → 291	bZIP transcription factor	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: According to PubMed:11830526, exclusively expressed in the prostate. Expressed in breast and prostate cancer cell lines. Expressed in prostatic luminal epithelial cells (at protein level). Expression is significantly more abundant in p
• Sequence:

  MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
  QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
  ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
  LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
  YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
  LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
  GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM

• Sequence length: 395