Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84699
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP responsive element binding protein 3 like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CREB3L3
Synonyms (NCBI Gene) Gene synonyms aliases	CREB-H, CREBH, HYST1481, HYTG2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HYTG2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the basic-leucine zipper family and the AMP-dependent transcription factor family. The encoded protein is localized to the endoplasmic reticulum and acts as a transcription factor activated by cyclic AMP stimulation. The enco

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments
MIRT1969371	hsa-miR-3120-5p	CLIP-seq
MIRT2205501	hsa-miR-2467-3p	CLIP-seq
MIRT2205502	hsa-miR-2861	CLIP-seq
MIRT2205503	hsa-miR-3184	CLIP-seq
MIRT2205504	hsa-miR-3192	CLIP-seq
MIRT2205505	hsa-miR-423-5p	CLIP-seq
MIRT2205506	hsa-miR-4300	CLIP-seq
MIRT2205507	hsa-miR-4540	CLIP-seq
MIRT2205508	hsa-miR-661	CLIP-seq
MIRT2205509	hsa-miR-920	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	16469704
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11353085
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11353085
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	11353085
GO:0002675	Process	Positive regulation of acute inflammatory response	NAS	16469704
GO:0005515	Function	Protein binding	IPI	16469704, 20102225, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	16469704
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796, 16469704
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0016020	Component	Membrane	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	TAS
GO:0035497	Function	CAMP response element binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	16469704
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	11353085
GO:0046982	Function	Protein heterodimerization activity	IPI	16469704
GO:1990440	Process	Positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	16469704

MIM	HGNC	e!Ensembl
611998	18855	ENSG00000060566

Protein

UniProt ID

Q68CJ9

Protein name

Cyclic AMP-responsive element-binding protein 3-like protein 3 (cAMP-responsive element-binding protein 3-like protein 3) (Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3]

Protein function

Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	241 → 304	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Exclusively expressed in liver. Underexpressed in hepatocellular carcinoma tissues. {ECO:0000269|PubMed:11353085, ECO:0000269|PubMed:15800215}.

Sequence

MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV
KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS
RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL

Sequence length

461

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
HYPERTRIGLYCERIDEMIA	hypertriglyceridemia	GenCC
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Complex Regional Pain Syndromes	Associate	31217010
Endometrial Neoplasms	Associate	37880674
Hypertriglyceridemia	Associate	22135386, 32580631, 39562229
Pancreatitis	Associate	39562229
Urinary Bladder Neoplasms	Associate	34930465

CREB3L3 (cAMP responsive element binding protein 3 like 3)