Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84699
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 3 like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREB3L3
Synonyms (NCBI Gene) Gene synonyms aliases
CREB-H, CREBH, HYST1481, HYTG2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the basic-leucine zipper family and the AMP-dependent transcription factor family. The encoded protein is localized to the endoplasmic reticulum and acts as a transcription factor activated by cyclic AMP stimulation. The enco
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1969371 hsa-miR-3120-5p CLIP-seq
MIRT2205501 hsa-miR-2467-3p CLIP-seq
MIRT2205502 hsa-miR-2861 CLIP-seq
MIRT2205503 hsa-miR-3184 CLIP-seq
MIRT2205504 hsa-miR-3192 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16469704
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 11353085
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611998 18855 ENSG00000060566
Protein
UniProt ID Q68CJ9
Protein name Cyclic AMP-responsive element-binding protein 3-like protein 3 (cAMP-responsive element-binding protein 3-like protein 3) (Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3]
Protein function Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 241 304 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Exclusively expressed in liver. Underexpressed in hepatocellular carcinoma tissues. {ECO:0000269|PubMed:11353085, ECO:0000269|PubMed:15800215}.
Sequence
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV
KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLK
KLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS
RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
Sequence length 461
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
HYPERTRIGLYCERIDEMIA Hypertriglyceridemia 2, hypertriglyceridemia N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Complex Regional Pain Syndromes Associate 31217010
Endometrial Neoplasms Associate 37880674
Hypertriglyceridemia Associate 22135386, 32580631, 39562229
Pancreatitis Associate 39562229
Urinary Bladder Neoplasms Associate 34930465