Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64764
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 3 like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREB3L2
Synonyms (NCBI Gene) Gene synonyms aliases
BBF2H7
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002706 hsa-miR-124-3p Microarray 15685193
MIRT002706 hsa-miR-124-3p Microarray;Other 15685193
MIRT031185 hsa-miR-19b-3p Sequencing 20371350
MIRT051241 hsa-miR-16-5p CLASH 23622248
MIRT049799 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IMP 17178827
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608834 23720 ENSG00000182158
Protein
UniProt ID Q70SY1
Protein name Cyclic AMP-responsive element-binding protein 3-like protein 2 (cAMP-responsive element-binding protein 3-like protein 2) (BBF2 human homolog on chromosome 7) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 2]
Protein function Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic fac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 292 355 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in placenta, lung, spleen and intestine, and lowest levels in heart, brain, skeletal muscle, thymus, colon and leukocytes. In fetal tissues, the weakest expression is detected in brain and heart. {E
Sequence
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQ
KLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
Sequence length 520
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Ischemic Stroke Ischemic Stroke GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 36867706
Carcinogenesis Associate 34104084
Carcinoma Papillary Follicular Associate 25148236
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema Associate 27023521
Endometrial Stromal Tumors Associate 15640831, 19605340, 20471519, 20499220, 21406083, 21536545, 25231134, 37905642
Fibrosarcoma Associate 20499220, 25231134
Glioblastoma Stimulate 25955804
Glioma Associate 27023521
Leukemia Biphenotypic Acute Associate 36439178
Neoplasms Associate 25955804, 26133168