Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10488
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP responsive element binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CREB3
Synonyms (NCBI Gene) Gene synonyms aliases	LUMAN, LZIP, sLZIP
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also as

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019911	hsa-miR-375	Microarray	20215506
MIRT908625	hsa-miR-1976	CLIP-seq
MIRT908626	hsa-miR-3155	CLIP-seq
MIRT908627	hsa-miR-3155b	CLIP-seq
MIRT908628	hsa-miR-370	CLIP-seq
MIRT908629	hsa-miR-4329	CLIP-seq
MIRT908630	hsa-miR-4663	CLIP-seq
MIRT908631	hsa-miR-4786-5p	CLIP-seq
MIRT908632	hsa-miR-484	CLIP-seq
MIRT908633	hsa-miR-769-5p	CLIP-seq
MIRT1969290	hsa-miR-4520a-3p	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17296613
RELA	Unknown	17296613

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16940180
GO:0005515	Function	Protein binding	IPI	10629049, 10871379, 15705566, 17483474, 18391022, 20102225, 20195357, 21516116, 29547901, 31515488
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IC	16940180
GO:0005634	Component	Nucleus	IDA	20546900
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006935	Process	Chemotaxis	IEA
GO:0006990	Process	Positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IDA	16940180
GO:0016021	Component	Integral component of membrane	IEA
GO:0016032	Process	Viral process	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	TAS
GO:0035497	Function	CAMP response element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16940180, 17296613
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16940180
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	17296613
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	16940180
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
606443	2347	ENSG00000107175

Protein

UniProt ID

O43889

Protein name

Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Lu

Protein function

Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription (PubMed:10984507, PubMed:15845366, PubMed:16940180, PubMed:19779205, PubMed:9271389). Plays a role in the unfolded protei

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	148 → 211	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:19779205, PubMed:9271389). Expressed in dendritic cells (DC). Weakly expressed in monocytes (at protein level) (PubMed:20546900). {ECO:0000269|PubMed:19779205, ECO:0000269|PubMed:20546900, ECO:0000269|Pub

Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG

Sequence length

371

Interactions

View interactions

CREB3 (cAMP responsive element binding protein 3)