Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10488
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP responsive element binding protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CREB3
Synonyms (NCBI Gene) Gene synonyms aliases	LUMAN, LZIP, sLZIP
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also as

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019911	hsa-miR-375	Microarray	20215506
MIRT908625	hsa-miR-1976	CLIP-seq
MIRT908626	hsa-miR-3155	CLIP-seq
MIRT908627	hsa-miR-3155b	CLIP-seq
MIRT908628	hsa-miR-370	CLIP-seq
MIRT908629	hsa-miR-4329	CLIP-seq
MIRT908630	hsa-miR-4663	CLIP-seq
MIRT908631	hsa-miR-4786-5p	CLIP-seq
MIRT908632	hsa-miR-484	CLIP-seq
MIRT908633	hsa-miR-769-5p	CLIP-seq
MIRT1969290	hsa-miR-4520a-3p	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq
MIRT2508657	hsa-miR-1225-3p	CLIP-seq
MIRT2447593	hsa-miR-1225-5p	CLIP-seq
MIRT2508658	hsa-miR-1233	CLIP-seq
MIRT2508659	hsa-miR-1280	CLIP-seq
MIRT2508660	hsa-miR-129-3p	CLIP-seq
MIRT2447594	hsa-miR-1912	CLIP-seq
MIRT2205353	hsa-miR-28-5p	CLIP-seq
MIRT2205354	hsa-miR-3139	CLIP-seq
MIRT2508661	hsa-miR-3194-5p	CLIP-seq
MIRT2508662	hsa-miR-3650	CLIP-seq
MIRT2508663	hsa-miR-3660	CLIP-seq
MIRT2447595	hsa-miR-3667-5p	CLIP-seq
MIRT2508664	hsa-miR-4264	CLIP-seq
MIRT1969291	hsa-miR-4520b-3p	CLIP-seq
MIRT2508665	hsa-miR-4526	CLIP-seq
MIRT1969292	hsa-miR-4529-3p	CLIP-seq
MIRT2447596	hsa-miR-4643	CLIP-seq
MIRT2508666	hsa-miR-4687-5p	CLIP-seq
MIRT2447597	hsa-miR-4717-3p	CLIP-seq
MIRT2205355	hsa-miR-558	CLIP-seq
MIRT2508667	hsa-miR-595	CLIP-seq
MIRT2447598	hsa-miR-642b	CLIP-seq
MIRT2205356	hsa-miR-708	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17296613
RELA	Unknown	17296613

Show/Hide all(71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	20091349
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	15845366, 16940180
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	16940180
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	11711630
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16940180
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16940180
GO:0001558	Process	Regulation of cell growth	IDA	20141198
GO:0003677	Function	DNA binding	IDA	9271389, 10675342
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	16940180
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10675342, 20141198
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9271389, 10629049, 10675342, 10871379, 15001559, 15705566, 17483474, 18391022, 20102225, 20195357, 20546900, 21516116, 23661758, 25910212, 29547901, 31515488, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10675342, 16940180, 19779205, 20141198, 20546900
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18391022, 19779205, 20091349
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	10623756, 10675342
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	10623756
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	20091349, 20546900
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IMP	10623756
GO:0005829	Component	Cytosol	IMP	15001559
GO:0006351	Process	DNA-templated transcription	IDA	9271389
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006935	Process	Chemotaxis	IEA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0008140	Function	CAMP response element binding protein binding	IDA	9271389
GO:0016020	Component	Membrane	IDA	19779205
GO:0016020	Component	Membrane	IDA	10623756, 19779205
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA	18391022
GO:0019046	Process	Release from viral latency	TAS	10623756
GO:0030335	Process	Positive regulation of cell migration	IMP	15001559
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	16940180, 18391022
GO:0031726	Function	CCR1 chemokine receptor binding	IDA	15001559
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15845366
GO:0042127	Process	Regulation of cell population proliferation	IMP	10675342
GO:0042802	Function	Identical protein binding	IPI	21516116, 23661758
GO:0042803	Function	Protein homodimerization activity	IDA	10675342, 20141198
GO:0042981	Process	Regulation of apoptotic process	IDA	16940180
GO:0043025	Component	Neuronal cell body	IDA	20091349
GO:0045786	Process	Negative regulation of cell cycle	NAS	10623756
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9271389
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15845366, 16940180, 17296613, 18391022, 20141198
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16940180
GO:0046983	Function	Protein dimerization activity	TAS	10623756
GO:0050930	Process	Induction of positive chemotaxis	IDA	19779205
GO:0050930	Process	Induction of positive chemotaxis	IDA	19779205
GO:0050930	Process	Induction of positive chemotaxis	IMP	15001559
GO:0051928	Process	Positive regulation of calcium ion transport	IMP	15001559
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	17296613
GO:0090045	Process	Positive regulation of deacetylase activity	IDA	19779205
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	16940180
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
606443	2347	ENSG00000107175

Protein

UniProt ID

O43889

Protein name

Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Lu

Protein function

Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription (PubMed:10984507, PubMed:15845366, PubMed:16940180, PubMed:19779205, PubMed:9271389). Plays a role in the unfolded protei

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	148 → 211	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:19779205, PubMed:9271389). Expressed in dendritic cells (DC). Weakly expressed in monocytes (at protein level) (PubMed:20546900). {ECO:0000269|PubMed:19779205, ECO:0000269|PubMed:20546900, ECO:0000269|Pub

Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG

Sequence length

371

Interactions

View interactions

CREB3 (cAMP responsive element binding protein 3)