Gene Gene information from NCBI Gene database.
Entrez ID 1385
Gene name CAMP responsive element binding protein 1
Gene symbol CREB1
Synonyms (NCBI Gene)
CREBCREB-1
Chromosome 2
Chromosome location 2q33.3
Summary This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kin
miRNA miRNA information provided by mirtarbase database.
1300
miRTarBase ID miRNA Experiments Reference
MIRT000066 hsa-miR-34b-5p ReviewLuciferase reporter assay 19461653
MIRT004766 hsa-miR-103a-3p Luciferase reporter assayqRT-PCRWestern blot 20886090
MIRT000066 hsa-miR-34b-5p Luciferase reporter assayqRT-PCRWestern blot 19258499
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
ATF5 Activation 17140605
CREBBP Activation 19564345
CREM Repression 11988318
FOXO4 Activation 20136501
SP1 Unknown 17937658
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
136
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 19861239
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
123810 2345 ENSG00000118260
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P16220
Protein name Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)
Protein function Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters (By similarity). Transcription activation is enhanced by th
PDB 2LXT , 5ZK1 , 5ZKO , 7TBH
Family and domains

Pfam


Warning: Undefined array key 339 in /var/www/html/new_GgeneT.php on line 1017
Accession ID Position in sequence Description Type
PF02173 pKID 113 153 pKID domain Family
PF00170 bZIP_1 281 340 bZIP transcription factor Coiled-coil
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITT
VTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Sequence length 327
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Variant of unknown significance Uncertain significance rs387906617 RCV000022519
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 25814225
Acute Disease Associate 11895805
Adenocarcinoma Associate 25382680
Adenocarcinoma of Lung Associate 33846793
Alcoholism Associate 36982708
Alzheimer Disease Associate 17908236, 20037212, 23168992, 23341039, 24436131, 27480489, 30080220, 32755048, 34556089, 36153426, 36982708, 39210294
Alzheimer Disease Inhibit 27480489, 37762325
Amyotrophic Lateral Sclerosis Associate 33692125
Aneuploidy Associate 16822311
Anxiety Associate 19194961, 20047710