Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1385
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREB1
Synonyms (NCBI Gene) Gene synonyms aliases
CREB, CREB-1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000066 hsa-miR-34b-5p Review, Luciferase reporter assay 19461653
MIRT004766 hsa-miR-103a-3p Luciferase reporter assay, qRT-PCR, Western blot 20886090
MIRT000066 hsa-miR-34b-5p Luciferase reporter assay, qRT-PCR, Western blot 19258499
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
Transcription factors
Transcription factor Regulation Reference
ATF5 Activation 17140605
CREBBP Activation 19564345
CREM Repression 11988318
FOXO4 Activation 20136501
SP1 Unknown 17937658
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 19861239
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123810 2345 ENSG00000118260
Protein
UniProt ID P16220
Protein name Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)
Protein function Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters (By similarity). Transcription activation is enhanced by th
PDB 2LXT , 5ZK1 , 5ZKO , 7TBH
Family and domains

Pfam


Warning: Undefined array key 339 in /var/www/html/new_GgeneT.php on line 1417
Accession ID Position in sequence Description Type
PF02173 pKID 113 153 pKID domain Family
PF00170 bZIP_1 281 340 bZIP transcription factor Coiled-coil
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITT
VTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Sequence length 327
Interactions View interactions
<