Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1027
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase inhibitor 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDKN1B
Synonyms (NCBI Gene) Gene synonyms aliases	CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MEN4
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle

Show/Hide all(1094)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blot	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blot	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	18413744
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	18413744
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blot	18413744
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blot	18413744
MIRT000137	hsa-miR-221-3p	qRT-PCR, Luciferase reporter assay, Western blot	19153141
MIRT000131	hsa-miR-222-3p	qRT-PCR, Luciferase reporter assay, Western blot	19153141
MIRT000137	hsa-miR-221-3p	Western blot, Northern blot	19107213
MIRT000137	hsa-miR-221-3p	Western blot, Northern blot	19107213
MIRT000131	hsa-miR-222-3p	Western blot, Northern blot	19107213
MIRT000131	hsa-miR-222-3p	Western blot, Northern blot	19107213
MIRT006589	hsa-miR-221-3p	qRT-PCR, Luciferase reporter assay, Western blot	19749093
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	19859555
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blot	19859555
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19150885
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18834855
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19153141
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18246122
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18983236
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18521080
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19859555
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19749093
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19150885
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19153141
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	18246122
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	18983236
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19859555
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assay, Western blot	19273599
MIRT000137	hsa-miR-221-3p	Review	19815577
MIRT000131	hsa-miR-222-3p	Review	19815577
MIRT000137	hsa-miR-221-3p	immunohistochemistry, Microarray, qRT-PCR	20012062
MIRT000131	hsa-miR-222-3p	immunohistochemistry, Microarray, qRT-PCR	20012062
MIRT000137	hsa-miR-221-3p	Review	20130964
MIRT000131	hsa-miR-222-3p	Review	20130964
MIRT000137	hsa-miR-221-3p	Northern blot, qRT-PCR, Western blot	20018759
MIRT000131	hsa-miR-222-3p	Northern blot, qRT-PCR, Western blot	20018759
MIRT000131	hsa-miR-222-3p	Northern blot, qRT-PCR, Western blot	20018759
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18417445
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18417445
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18417445
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18417445
MIRT000137	hsa-miR-221-3p	qRT-PCR, Western blot	18708351
MIRT000131	hsa-miR-222-3p	qRT-PCR, Western blot	18708351
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	19088079
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	17627278
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	17627278
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17627278
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17627278
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	17627278
MIRT005064	hsa-miR-192-5p	Luciferase reporter assay	17627278
MIRT005065	hsa-miR-196a-5p	Luciferase reporter assay	17627278
MIRT005066	hsa-miR-190a-5p	Luciferase reporter assay	17627278
MIRT005067	hsa-miR-218-5p	Luciferase reporter assay	17627278
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	17721077
MIRT000131	hsa-miR-222-3p	Western blot	17721077
MIRT000137	hsa-miR-221-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000137	hsa-miR-221-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000137	hsa-miR-221-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000131	hsa-miR-222-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000131	hsa-miR-222-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000131	hsa-miR-222-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	19424584
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	18155131
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blot	18155131
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	20816961
MIRT000131	hsa-miR-222-3p	qRT-PCR	23447020
MIRT000131	hsa-miR-222-3p	Reporter assay;Western blot	19424584
MIRT000131	hsa-miR-222-3p	Western blot;Other	17569667
MIRT000131	hsa-miR-222-3p	Reporter assay	17721077
MIRT000131	hsa-miR-222-3p	Reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Northern blot	17569667
MIRT000131	hsa-miR-222-3p	Reporter assay	18413744
MIRT000137	hsa-miR-221-3p	Reporter assay;Western blot	19424584
MIRT000137	hsa-miR-221-3p	Sequencing	20371350
MIRT000137	hsa-miR-221-3p	Reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Northern blot;Western blot	17569667
MIRT000137	hsa-miR-221-3p	Reporter assay	17721077
MIRT000137	hsa-miR-221-3p	Reporter assay	18413744
MIRT004554	hsa-miR-181a-5p	Reporter assay;Western blot;qRT-PCR	19273599
MIRT027709	hsa-miR-98-5p	Microarray	19088304
MIRT005063	hsa-miR-24-3p	Sequencing	20371350
MIRT005063	hsa-miR-24-3p	Microarray	19748357
MIRT005063	hsa-miR-24-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23553486
MIRT004554	hsa-miR-181a-5p	CLASH	23622248
MIRT052676	hsa-miR-1260b	CLASH	23622248
MIRT000131	hsa-miR-222-3p	Immunofluorescence, Luciferase reporter assay, Western blot	24137356
MIRT005065	hsa-miR-196a-5p	and SGC-7901 and the normal gastric epithelium cell line (GES-1)"	22343731
MIRT005065	hsa-miR-196a-5p	and SGC-7901 and the normal gastric epithelium cell line (GES-1)"	22343731
MIRT053475	hsa-miR-148a-3p	In situ hybridization, Luciferase reporter assay, Northern blot, Western blot	21552422
MIRT005065	hsa-miR-196a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22343731
MIRT005065	hsa-miR-196a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22343731
MIRT054250	hsa-miR-194-5p	Immunohistochemistry, Immunoprecipitation, Luciferase reporter assay, QRTPCR, Westren Blot	23584484
MIRT000137	hsa-miR-221-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24586944
MIRT005065	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24423924
MIRT437459	hsa-miR-182-5p	Luciferase reporter assay	23249749
MIRT000137	hsa-miR-221-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25436097
MIRT437988	hsa-miR-200b-3p	Luciferase reporter assay	24151081
MIRT438015	hsa-miR-452-5p	Luciferase reporter assay, Western blot	24381057
MIRT438015	hsa-miR-452-5p	Luciferase reporter assay, Western blot	24381057
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	Luciferase reporter assay	24151081
MIRT438015	hsa-miR-452-5p	Luciferase reporter assay, Western blot	24381057
MIRT438015	hsa-miR-452-5p	Luciferase reporter assay, Western blot	24381057
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCR, Luciferase reporter assay, Western blot	24667864
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479436	hsa-miR-302f	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT568108	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT568107	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT438015	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT568106	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT437988	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT568105	hsa-miR-429	PAR-CLIP	20371350
MIRT568104	hsa-miR-7151-5p	PAR-CLIP	20371350
MIRT568103	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT568102	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT479417	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT479416	hsa-miR-3148	PAR-CLIP	20371350
MIRT479414	hsa-miR-4672	PAR-CLIP	20371350
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	21572407
MIRT000131	hsa-miR-222-3p	PAR-CLIP	21572407
MIRT479412	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT479411	hsa-miR-548ac	PAR-CLIP	21572407
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT479407	hsa-miR-548z	PAR-CLIP	21572407
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT479399	hsa-miR-548m	PAR-CLIP	21572407
MIRT479398	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT479397	hsa-miR-548ag	PAR-CLIP	21572407
MIRT479396	hsa-miR-548ai	PAR-CLIP	21572407
MIRT479395	hsa-miR-548ba	PAR-CLIP	21572407
MIRT479394	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT479393	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	21572407
MIRT479391	hsa-miR-187-5p	PAR-CLIP	21572407
MIRT479390	hsa-miR-548v	PAR-CLIP	21572407
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	21572407
MIRT541377	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541376	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT494318	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541375	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT541374	hsa-miR-1265	PAR-CLIP	21572407
MIRT541373	hsa-miR-8060	PAR-CLIP	21572407
MIRT541372	hsa-miR-219b-5p	PAR-CLIP	21572407
MIRT541371	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT541370	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT541369	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT541368	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT541367	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT541366	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT541365	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT494312	hsa-miR-4276	PAR-CLIP	21572407
MIRT541364	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT541363	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT494307	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT479437	hsa-miR-877-5p	PAR-CLIP	22012620
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT479427	hsa-miR-1827	PAR-CLIP	22012620
MIRT479425	hsa-miR-155-5p	PAR-CLIP	22012620
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	22012620
MIRT479423	hsa-miR-153-3p	PAR-CLIP	22012620
MIRT479421	hsa-miR-448	PAR-CLIP	22012620
MIRT479420	hsa-miR-1303	PAR-CLIP	22012620
MIRT000137	hsa-miR-221-3p	PAR-CLIP	22012620
MIRT000131	hsa-miR-222-3p	PAR-CLIP	22012620
MIRT479412	hsa-miR-455-5p	PAR-CLIP	22012620
MIRT479411	hsa-miR-548ac	PAR-CLIP	22012620
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT479407	hsa-miR-548z	PAR-CLIP	22012620
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT479399	hsa-miR-548m	PAR-CLIP	22012620
MIRT479398	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT479397	hsa-miR-548ag	PAR-CLIP	22012620
MIRT479396	hsa-miR-548ai	PAR-CLIP	22012620
MIRT479395	hsa-miR-548ba	PAR-CLIP	22012620
MIRT479394	hsa-miR-570-5p	PAR-CLIP	22012620
MIRT479393	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT538590	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT538589	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT538588	hsa-miR-4287	PAR-CLIP	22012620
MIRT538587	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT479391	hsa-miR-187-5p	PAR-CLIP	22012620
MIRT479390	hsa-miR-548v	PAR-CLIP	22012620
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT479427	hsa-miR-1827	PAR-CLIP	23446348
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT479421	hsa-miR-448	PAR-CLIP	23446348
MIRT479420	hsa-miR-1303	PAR-CLIP	23446348
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT479411	hsa-miR-548ac	PAR-CLIP	23446348
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT479407	hsa-miR-548z	PAR-CLIP	23446348
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT479399	hsa-miR-548m	PAR-CLIP	23446348
MIRT479397	hsa-miR-548ag	PAR-CLIP	23446348
MIRT479396	hsa-miR-548ai	PAR-CLIP	23446348
MIRT479395	hsa-miR-548ba	PAR-CLIP	23446348
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23446348
MIRT479390	hsa-miR-548v	PAR-CLIP	23446348
MIRT507809	hsa-miR-4463	PAR-CLIP	23446348
MIRT507808	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT507807	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT507806	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT507805	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT507804	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT507802	hsa-miR-4464	PAR-CLIP	23446348
MIRT507803	hsa-miR-4748	PAR-CLIP	23446348
MIRT507801	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT507800	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507799	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507798	hsa-miR-8089	PAR-CLIP	23446348
MIRT507797	hsa-miR-1267	PAR-CLIP	23446348
MIRT507796	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT507795	hsa-miR-1185-5p	PAR-CLIP	23446348
MIRT507794	hsa-miR-3679-5p	PAR-CLIP	23446348
MIRT507793	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT507792	hsa-miR-3616-3p	PAR-CLIP	23446348
MIRT507791	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT507790	hsa-miR-5191	PAR-CLIP	23446348
MIRT507789	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT507788	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507787	hsa-miR-449a	PAR-CLIP	23446348
MIRT507786	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT507785	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT507784	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT507783	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT507782	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT507781	hsa-miR-3175	PAR-CLIP	23446348
MIRT507780	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT507779	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT507778	hsa-miR-6825-5p	PAR-CLIP	23446348
MIRT507777	hsa-miR-3150a-3p	PAR-CLIP	23446348
MIRT507776	hsa-miR-6763-5p	PAR-CLIP	23446348
MIRT507775	hsa-miR-4743-3p	PAR-CLIP	23446348
MIRT507774	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT507773	hsa-miR-3147	PAR-CLIP	23446348
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT494318	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT494317	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494316	hsa-miR-4282	PAR-CLIP	23592263
MIRT494315	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT494314	hsa-miR-4255	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT494313	hsa-miR-5701	PAR-CLIP	23592263
MIRT494312	hsa-miR-4276	PAR-CLIP	23592263
MIRT494311	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT494307	hsa-miR-335-3p	PAR-CLIP	23592263
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479436	hsa-miR-302f	PAR-CLIP	23592263
MIRT479435	hsa-miR-5694	PAR-CLIP	23592263
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT479429	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT479428	hsa-miR-4729	PAR-CLIP	23592263
MIRT479427	hsa-miR-1827	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT479422	hsa-miR-5696	PAR-CLIP	23592263
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT479421	hsa-miR-448	PAR-CLIP	23592263
MIRT479419	hsa-miR-3658	PAR-CLIP	23592263
MIRT479420	hsa-miR-1303	PAR-CLIP	23592263
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT479417	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT479416	hsa-miR-3148	PAR-CLIP	23592263
MIRT479414	hsa-miR-4672	PAR-CLIP	23592263
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23592263
MIRT479411	hsa-miR-548ac	PAR-CLIP	23592263
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT479407	hsa-miR-548z	PAR-CLIP	23592263
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT479399	hsa-miR-548m	PAR-CLIP	23592263
MIRT479398	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT479397	hsa-miR-548ag	PAR-CLIP	23592263
MIRT479396	hsa-miR-548ai	PAR-CLIP	23592263
MIRT479395	hsa-miR-548ba	PAR-CLIP	23592263
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT479393	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	23592263
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT479390	hsa-miR-548v	PAR-CLIP	23592263
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	26847530
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	26847530
MIRT732308	hsa-miR-148a-5p	Luciferase reporter assay, Western blot	27292025
MIRT732308	hsa-miR-148a-5p	Luciferase reporter assay, Western blot	27292025
MIRT004554	hsa-miR-181a-5p	qRT-PCR, Western blot	27534652
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	26044523
MIRT053475	hsa-miR-148a-3p	Luciferase reporter assay, Western blot	27842905
MIRT053475	hsa-miR-148a-3p	Luciferase reporter assay, Western blot	27842905
MIRT479418	hsa-miR-196b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33842615
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, In situ hybridization, Flow cytometry	32590883
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33312752
MIRT736321	hsa-miR-150-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32963616
MIRT736561	hsa-miR-575	Luciferase reporter assay, Western blotting, qRT-PCR	32929377
MIRT438015	hsa-miR-452-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	31933800
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479436	hsa-miR-302f	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT568108	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT568107	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT438015	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT568106	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT437988	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT568105	hsa-miR-429	PAR-CLIP	20371350
MIRT568104	hsa-miR-7151-5p	PAR-CLIP	20371350
MIRT568103	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT568102	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT479417	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT479416	hsa-miR-3148	PAR-CLIP	20371350
MIRT479414	hsa-miR-4672	PAR-CLIP	20371350
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	21572407
MIRT000131	hsa-miR-222-3p	PAR-CLIP	21572407
MIRT479412	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT479411	hsa-miR-548ac	PAR-CLIP	21572407
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT479407	hsa-miR-548z	PAR-CLIP	21572407
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT479399	hsa-miR-548m	PAR-CLIP	21572407
MIRT479398	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT479397	hsa-miR-548ag	PAR-CLIP	21572407
MIRT479396	hsa-miR-548ai	PAR-CLIP	21572407
MIRT479395	hsa-miR-548ba	PAR-CLIP	21572407
MIRT479394	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT479393	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	21572407
MIRT479391	hsa-miR-187-5p	PAR-CLIP	21572407
MIRT479390	hsa-miR-548v	PAR-CLIP	21572407
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	21572407
MIRT541377	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541376	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT494318	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541375	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT541374	hsa-miR-1265	PAR-CLIP	21572407
MIRT541373	hsa-miR-8060	PAR-CLIP	21572407
MIRT541372	hsa-miR-219b-5p	PAR-CLIP	21572407
MIRT541371	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT541370	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT541369	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT541368	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT541367	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT541366	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT541365	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT494312	hsa-miR-4276	PAR-CLIP	21572407
MIRT541364	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT541363	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT494307	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT479437	hsa-miR-877-5p	PAR-CLIP	22012620
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT479427	hsa-miR-1827	PAR-CLIP	22012620
MIRT479425	hsa-miR-155-5p	PAR-CLIP	22012620
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	22012620
MIRT479423	hsa-miR-153-3p	PAR-CLIP	22012620
MIRT479421	hsa-miR-448	PAR-CLIP	22012620
MIRT479420	hsa-miR-1303	PAR-CLIP	22012620
MIRT000137	hsa-miR-221-3p	PAR-CLIP	22012620
MIRT000131	hsa-miR-222-3p	PAR-CLIP	22012620
MIRT479412	hsa-miR-455-5p	PAR-CLIP	22012620
MIRT479411	hsa-miR-548ac	PAR-CLIP	22012620
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT479407	hsa-miR-548z	PAR-CLIP	22012620
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT479399	hsa-miR-548m	PAR-CLIP	22012620
MIRT479398	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT479397	hsa-miR-548ag	PAR-CLIP	22012620
MIRT479396	hsa-miR-548ai	PAR-CLIP	22012620
MIRT479395	hsa-miR-548ba	PAR-CLIP	22012620
MIRT479394	hsa-miR-570-5p	PAR-CLIP	22012620
MIRT479393	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT538590	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT538589	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT538588	hsa-miR-4287	PAR-CLIP	22012620
MIRT538587	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT479391	hsa-miR-187-5p	PAR-CLIP	22012620
MIRT479390	hsa-miR-548v	PAR-CLIP	22012620
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT479427	hsa-miR-1827	PAR-CLIP	23446348
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT479421	hsa-miR-448	PAR-CLIP	23446348
MIRT479420	hsa-miR-1303	PAR-CLIP	23446348
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT479411	hsa-miR-548ac	PAR-CLIP	23446348
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT479407	hsa-miR-548z	PAR-CLIP	23446348
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT479399	hsa-miR-548m	PAR-CLIP	23446348
MIRT479397	hsa-miR-548ag	PAR-CLIP	23446348
MIRT479396	hsa-miR-548ai	PAR-CLIP	23446348
MIRT479395	hsa-miR-548ba	PAR-CLIP	23446348
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23446348
MIRT479390	hsa-miR-548v	PAR-CLIP	23446348
MIRT507809	hsa-miR-4463	PAR-CLIP	23446348
MIRT507808	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT507807	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT507806	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT507805	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT507804	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT507802	hsa-miR-4464	PAR-CLIP	23446348
MIRT507803	hsa-miR-4748	PAR-CLIP	23446348
MIRT507801	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT507800	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507799	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507798	hsa-miR-8089	PAR-CLIP	23446348
MIRT507797	hsa-miR-1267	PAR-CLIP	23446348
MIRT507796	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT507795	hsa-miR-1185-5p	PAR-CLIP	23446348
MIRT507794	hsa-miR-3679-5p	PAR-CLIP	23446348
MIRT507793	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT507792	hsa-miR-3616-3p	PAR-CLIP	23446348
MIRT507791	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT507790	hsa-miR-5191	PAR-CLIP	23446348
MIRT507789	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT507788	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507787	hsa-miR-449a	PAR-CLIP	23446348
MIRT507786	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT507785	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT507784	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT507783	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT507782	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT507781	hsa-miR-3175	PAR-CLIP	23446348
MIRT507780	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT507779	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT507778	hsa-miR-6825-5p	PAR-CLIP	23446348
MIRT507777	hsa-miR-3150a-3p	PAR-CLIP	23446348
MIRT507776	hsa-miR-6763-5p	PAR-CLIP	23446348
MIRT507775	hsa-miR-4743-3p	PAR-CLIP	23446348
MIRT507774	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT507773	hsa-miR-3147	PAR-CLIP	23446348
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT494318	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT494317	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494316	hsa-miR-4282	PAR-CLIP	23592263
MIRT494315	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT494314	hsa-miR-4255	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT494313	hsa-miR-5701	PAR-CLIP	23592263
MIRT494312	hsa-miR-4276	PAR-CLIP	23592263
MIRT494311	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT494307	hsa-miR-335-3p	PAR-CLIP	23592263
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479436	hsa-miR-302f	PAR-CLIP	23592263
MIRT479435	hsa-miR-5694	PAR-CLIP	23592263
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT479429	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT479428	hsa-miR-4729	PAR-CLIP	23592263
MIRT479427	hsa-miR-1827	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT479422	hsa-miR-5696	PAR-CLIP	23592263
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT479421	hsa-miR-448	PAR-CLIP	23592263
MIRT479419	hsa-miR-3658	PAR-CLIP	23592263
MIRT479420	hsa-miR-1303	PAR-CLIP	23592263
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT479417	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT479416	hsa-miR-3148	PAR-CLIP	23592263
MIRT479414	hsa-miR-4672	PAR-CLIP	23592263
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23592263
MIRT479411	hsa-miR-548ac	PAR-CLIP	23592263
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT479407	hsa-miR-548z	PAR-CLIP	23592263
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT479399	hsa-miR-548m	PAR-CLIP	23592263
MIRT479398	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT479397	hsa-miR-548ag	PAR-CLIP	23592263
MIRT479396	hsa-miR-548ai	PAR-CLIP	23592263
MIRT479395	hsa-miR-548ba	PAR-CLIP	23592263
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT479393	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	23592263
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT479390	hsa-miR-548v	PAR-CLIP	23592263
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT881709	hsa-miR-103b	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881711	hsa-miR-1185	CLIP-seq
MIRT881712	hsa-miR-1207-3p	CLIP-seq
MIRT881713	hsa-miR-122	CLIP-seq
MIRT881714	hsa-miR-1245	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881722	hsa-miR-194	CLIP-seq
MIRT881723	hsa-miR-196a	CLIP-seq
MIRT881724	hsa-miR-196b	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881732	hsa-miR-3065-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881734	hsa-miR-3189-5p	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT881736	hsa-miR-323-3p	CLIP-seq
MIRT881737	hsa-miR-330-3p	CLIP-seq
MIRT881738	hsa-miR-34a	CLIP-seq
MIRT881739	hsa-miR-3607-3p	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT881741	hsa-miR-3646	CLIP-seq
MIRT881742	hsa-miR-3647-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881744	hsa-miR-3688-3p	CLIP-seq
MIRT881745	hsa-miR-377	CLIP-seq
MIRT881746	hsa-miR-3921	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881749	hsa-miR-4254	CLIP-seq
MIRT881750	hsa-miR-4261	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881754	hsa-miR-4310	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881756	hsa-miR-4475	CLIP-seq
MIRT881757	hsa-miR-4490	CLIP-seq
MIRT881758	hsa-miR-4496	CLIP-seq
MIRT881759	hsa-miR-449b	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881762	hsa-miR-4642	CLIP-seq
MIRT881763	hsa-miR-4653-5p	CLIP-seq
MIRT881764	hsa-miR-4663	CLIP-seq
MIRT881765	hsa-miR-4668-5p	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT881767	hsa-miR-4718	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881769	hsa-miR-4765	CLIP-seq
MIRT881770	hsa-miR-4766-5p	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881773	hsa-miR-4795-3p	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881777	hsa-miR-485-3p	CLIP-seq
MIRT881778	hsa-miR-488	CLIP-seq
MIRT881779	hsa-miR-494	CLIP-seq
MIRT881780	hsa-miR-495	CLIP-seq
MIRT881781	hsa-miR-505	CLIP-seq
MIRT881782	hsa-miR-5096	CLIP-seq
MIRT881783	hsa-miR-519e	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881788	hsa-miR-539	CLIP-seq
MIRT881789	hsa-miR-548ae	CLIP-seq
MIRT881790	hsa-miR-548aj	CLIP-seq
MIRT881791	hsa-miR-548am	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881793	hsa-miR-548x	CLIP-seq
MIRT881794	hsa-miR-561	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881796	hsa-miR-582-3p	CLIP-seq
MIRT881797	hsa-miR-583	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881799	hsa-miR-593	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881801	hsa-miR-619	CLIP-seq
MIRT881802	hsa-miR-626	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881804	hsa-miR-656	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT881807	hsa-miR-939	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881713	hsa-miR-122	CLIP-seq
MIRT881714	hsa-miR-1245	CLIP-seq
MIRT1961219	hsa-miR-129-5p	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT881734	hsa-miR-3189-5p	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881749	hsa-miR-4254	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881757	hsa-miR-4490	CLIP-seq
MIRT1961225	hsa-miR-4519	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881764	hsa-miR-4663	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT1961226	hsa-miR-4694-3p	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881769	hsa-miR-4765	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT1961227	hsa-miR-502-5p	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881794	hsa-miR-561	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881796	hsa-miR-582-3p	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881801	hsa-miR-619	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881709	hsa-miR-103b	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881712	hsa-miR-1207-3p	CLIP-seq
MIRT2197957	hsa-miR-1261	CLIP-seq
MIRT2197958	hsa-miR-141	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT2197959	hsa-miR-1914	CLIP-seq
MIRT881722	hsa-miR-194	CLIP-seq
MIRT881723	hsa-miR-196a	CLIP-seq
MIRT881724	hsa-miR-196b	CLIP-seq
MIRT2197960	hsa-miR-199a-5p	CLIP-seq
MIRT2197961	hsa-miR-199b-5p	CLIP-seq
MIRT2197962	hsa-miR-200a	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT2197963	hsa-miR-218	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT2197964	hsa-miR-3074-5p	CLIP-seq
MIRT2197965	hsa-miR-3124-3p	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT881736	hsa-miR-323-3p	CLIP-seq
MIRT881737	hsa-miR-330-3p	CLIP-seq
MIRT881739	hsa-miR-3607-3p	CLIP-seq
MIRT2197966	hsa-miR-3611	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT2197967	hsa-miR-3667-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT2197968	hsa-miR-3691-5p	CLIP-seq
MIRT881745	hsa-miR-377	CLIP-seq
MIRT881746	hsa-miR-3921	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881754	hsa-miR-4310	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881756	hsa-miR-4475	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT1961225	hsa-miR-4519	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881762	hsa-miR-4642	CLIP-seq
MIRT881763	hsa-miR-4653-5p	CLIP-seq
MIRT2197969	hsa-miR-4662a-5p	CLIP-seq
MIRT2197970	hsa-miR-4670-3p	CLIP-seq
MIRT2197971	hsa-miR-4676-5p	CLIP-seq
MIRT2197972	hsa-miR-4684-5p	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT1961226	hsa-miR-4694-3p	CLIP-seq
MIRT881767	hsa-miR-4718	CLIP-seq
MIRT2197973	hsa-miR-4752	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881770	hsa-miR-4766-5p	CLIP-seq
MIRT2197974	hsa-miR-4768-5p	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881773	hsa-miR-4795-3p	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881777	hsa-miR-485-3p	CLIP-seq
MIRT881778	hsa-miR-488	CLIP-seq
MIRT1961227	hsa-miR-502-5p	CLIP-seq
MIRT881782	hsa-miR-5096	CLIP-seq
MIRT881783	hsa-miR-519e	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881789	hsa-miR-548ae	CLIP-seq
MIRT881790	hsa-miR-548aj	CLIP-seq
MIRT881791	hsa-miR-548am	CLIP-seq
MIRT881793	hsa-miR-548x	CLIP-seq
MIRT2197975	hsa-miR-579	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881799	hsa-miR-593	CLIP-seq
MIRT2197976	hsa-miR-595	CLIP-seq
MIRT2197977	hsa-miR-600	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881802	hsa-miR-626	CLIP-seq
MIRT2197978	hsa-miR-636	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT2197979	hsa-miR-648	CLIP-seq
MIRT881804	hsa-miR-656	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT2197963	hsa-miR-218	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT2197976	hsa-miR-595	CLIP-seq
MIRT2197978	hsa-miR-636	CLIP-seq
MIRT2197979	hsa-miR-648	CLIP-seq
MIRT2501224	hsa-miR-3136-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT2501225	hsa-miR-4439	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT2501226	hsa-miR-943	CLIP-seq
MIRT2501227	hsa-miR-944	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq

Transcription factors

Show/Hide all(28)

Transcription factor	Regulation	Reference
BRCA1	Activation	18025037
BRCA1	Unknown	16331276
COPS5	Repression	16951171
CUX1	Unknown	19332113
ESR1	Repression	17681750
FHL2	Activation	21377781
FOXO1	Activation	21418583
HOXB7	Repression	21474578
ING4	Activation	20707719
ING4	Unknown	18399550
IRF9	Activation	15362048
KAT2B	Activation	19525977
KLF4	Activation	22170594
MEN1	Activation	10523037
MYCN	Unknown	16618721
NFYA	Activation	15064717
NFYB	Activation	15064717
NFYC	Activation	15064717
NR4A1	Activation	12842839
PROX1	Activation	17069925
SP1	Activation	12907235;15064717;16518840
SP1	Unknown	10542271;15951157;22415074
STAT3	Unknown	18320073
TP53	Unknown	15988033
UTF1	Unknown	23536577
VDR	Activation	16518840
VHL	Activation	10778984
ZNF300	Repression	21777376

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	8033212
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA	21873635
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	10208428
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0004860	Function	Protein kinase inhibitor activity	IMP	8684460
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA	21873635
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8033212, 10918569, 28666995
GO:0005515	Function	Protein binding	IPI	8684460, 8756624, 9106657, 9840943, 11961546, 12082530, 12093740, 15057270, 15480426, 15652749, 15890360, 16189514, 16209941, 16289477, 16326706, 16431923, 17053782, 17254966, 17254967, 17418410, 17698606, 18177895, 18593906, 18692475, 18805092, 19470470, 20596027, 21423214, 2142380
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11800646, 12093740
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	12093740
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007050	Process	Cell cycle arrest	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IMP	12093740
GO:0007507	Process	Heart development	ISS	24380855
GO:0008285	Process	Negative regulation of cell population proliferation	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19266349
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	19838216
GO:0010942	Process	Positive regulation of cell death	IDA	19266349
GO:0019901	Function	Protein kinase binding	IPI	15024385
GO:0019903	Function	Protein phosphatase binding	IPI	19838216
GO:0030308	Process	Negative regulation of cell growth	IDA	10208428
GO:0030332	Function	Cyclin binding	IPI	15024385
GO:0030332	Function	Cyclin binding	ISS	24380855
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	21628527
GO:0033673	Process	Negative regulation of kinase activity	IDA	19170105
GO:0042326	Process	Negative regulation of phosphorylation	IDA	10208428
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0044877	Function	Protein-containing complex binding	IPI	8684460, 15024385
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	19056892
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	28666995
GO:0045786	Process	Negative regulation of cell cycle	IMP	18305109
GO:0045787	Process	Positive regulation of cell cycle	TAS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	19170105
GO:0045930	Process	Negative regulation of mitotic cell cycle	IBA	21873635
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	19266349
GO:0048102	Process	Autophagic cell death	IDA	12698196
GO:0051087	Function	Chaperone binding	IBA	21873635
GO:0071285	Process	Cellular response to lithium ion	IDA	19056892
GO:0071850	Process	Mitotic cell cycle arrest	IDA	19266349
GO:0071850	Process	Mitotic cell cycle arrest	ISS	24380855
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IMP	8033212
GO:1904030	Process	Negative regulation of cyclin-dependent protein kinase activity	IMP	8684460
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	19088079
GO:1905179	Process	Negative regulation of cardiac muscle tissue regeneration	ISS	24380855

MIM	HGNC	e!Ensembl
600778	1785	ENSG00000111276

Protein

UniProt ID

P46527

Protein name

Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)

Protein function

Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA (PubMed:28666995). Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A

PDB

1H27 , 1JSU , 2AST , 5UQ3 , 6ATH , 6P8E , 6P8F , 6P8G , 7B5L , 7B5M , 7B5R , 7OR8 , 7ORG , 7ORH , 7ORS , 7ORT , 8BYA , 8BYL , 8BZO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02234	CDI	31 → 79	Cyclin-dependent kinase inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney (at protein level) (PubMed:15509543). Expressed in all tissues tested (PubMed:8033212). Highest levels in skeletal muscle, lowest in liver and kidney (PubMed:8033212). {ECO:0000269|PubMed:15509543, ECO:0000269|PubMe

Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT

Sequence length

198

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	Source
Unknown
Colorectal Cancer	hereditary nonpolyposis colon cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GenCC, CBGDA
Multiple Endocrine Neoplasia	multiple endocrine neoplasia type 4, multiple endocrine neoplasia		GenCC
Diabetes	Diabetes		GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA
Hypertension	Hypertension		GWAS

Show/Hide Text Mining Associations (221)

Disease Name	Relationship Type	References
Associations from Text Mining
Acromegaly	Associate	22291433
Adenocarcinoma	Associate	16731604, 18415709, 9927492
Adenocarcinoma Follicular	Associate	16798934
Adenocarcinoma of Lung	Associate	16551617, 22372491, 30375484
Adenoma	Associate	34232602
Adenoma	Inhibit	9033255, 9250163
Adenomatous Polyposis Coli	Associate	15509520
Arthritis Rheumatoid	Associate	21676922
Arthritis Rheumatoid	Inhibit	22183962
Astrocytoma	Associate	15367334, 18345413
Ataxia Telangiectasia	Associate	11457838
Atherosclerosis	Associate	15061869, 17351341
Bicuspid Aortic Valve Disease	Stimulate	35439345
Biliary Tract Neoplasms	Associate	15596046
Brain Diseases	Associate	26908328
Breast Neoplasms	Associate	10188908, 10757805, 10908655, 12123335, 12700233, 12904306, 15627896, 15665120, 15802279, 15996662, 16168119, 16208702, 16216245, 17148774, 17690504 View all (18 more)
Breast Neoplasms	Inhibit	22199306
Breast Neoplasms Male	Associate	12123335
Burkitt Lymphoma	Associate	15665120, 9212741
Calcinosis Cutis	Associate	10840458
Carcinogenesis	Associate	15743786, 17008550, 17722244, 21289244, 21454826, 22291433, 23029392, 23155381, 23351380, 23725357, 29397868, 33316141, 35926659, 7655021, 9250163, 9466585 View all (1 more)
Carcinoid Tumor	Associate	29017393, 37954063
Carcinoma Ductal Breast	Associate	22199306
Carcinoma Hepatocellular	Associate	15133847, 15298730, 15457552, 15777850, 16014626, 16052694, 18781093, 18808421, 28713927, 29397868, 30473536, 33960941
Carcinoma in Situ	Inhibit	21683992
Carcinoma Non Small Cell Lung	Associate	21706050, 30873868, 9708810
Carcinoma Ovarian Epithelial	Associate	17409409, 9916926
Carcinoma Pancreatic Ductal	Associate	21262926
Carcinoma Papillary Follicular	Associate	28425432
Carcinoma Renal Cell	Associate	11920465, 18922157, 20339477, 20626751, 32229735
Carcinoma Squamous Cell	Associate	15743689
Carcinoma Transitional Cell	Associate	10514396
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	36806942
Cholangiocarcinoma	Associate	24574749, 25663461, 28882106, 35926659, 40682835
Chromosome 12p deletion	Associate	21422114, 8547659
Chromosome 12p deletion	Inhibit	26293672
Chromosome Aberrations	Associate	18596104
Clear cell metastatic renal cell carcinoma	Associate	33431761
Colonic Neoplasms	Associate	32232325
Colorectal Neoplasms	Associate	12467060, 15073847, 15717322, 16369045, 17072952, 17086168, 17239930, 18320073, 19276255, 19290007, 19505918, 19686745, 20673328, 21639915, 22970236 View all (9 more)
Coronary Artery Disease	Associate	23312942
Coronary Disease	Associate	36180886
Coronary Restenosis	Associate	23312942
Cushing Syndrome	Associate	35323929
Death	Associate	20626751, 27268646
Developmental Disabilities	Associate	23505216
Diabetes Mellitus	Inhibit	25409512
Diabetes Mellitus Type 2	Associate	27380896
Diabetic Foot	Associate	29115286
Diabetic Nephropathies	Associate	37745718, 40312440
Diabetic Retinopathy	Associate	29115286
Diarrhea 5 With Tufting Enteropathy Congenital	Inhibit	9466585
Disease	Associate	37239316
dopamine beta hydroxylase deficiency	Associate	22199306
Down Syndrome	Associate	10757805
Drug Related Side Effects and Adverse Reactions	Associate	21418583
Dyskinesias	Inhibit	9466585
Embryo Loss	Associate	21112821
Endocrine Gland Neoplasms	Associate	9033255
Endodermal Sinus Tumor	Associate	34117242
Endometrial Neoplasms	Inhibit	20565904
Endometrial Neoplasms	Associate	21454826, 22114462, 23029392, 28040131
Endometriosis	Associate	11334908, 18321488
Esophageal Neoplasms	Associate	14606065, 23301842
Esophageal Squamous Cell Carcinoma	Associate	27292876
Fibrocartilaginous embolism	Associate	30984546
Fibrosis	Associate	16052694
Gallbladder Neoplasms	Associate	17384652
Gastrointestinal Stromal Tumors	Associate	18474118, 31553483
Genetic Diseases Inborn	Associate	23555276
Gigantism	Associate	23505216
Glassy cell carcinoma of the cervix	Associate	14584070
Glioblastoma	Associate	15517868, 15542603, 17721077, 22217655, 27142352, 28381184, 35550147, 36792756
Glioma	Associate	10737594, 12698196, 17565690, 25399650, 26535026, 28582703
Glomerulonephritis	Associate	15208647
Glucose Intolerance	Associate	27411103
Granulosa Cell Tumor	Associate	23155381
Granulosa cell tumor of the ovary	Associate	31311113
Hashimoto Disease	Associate	12890807
Hematologic Neoplasms	Associate	7632960, 8547659
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30394935
Hereditary leiomyomatosis and renal cell cancer	Associate	15389259
Hodgkin Disease	Associate	15389259, 28432871
Hyperparathyroidism	Associate	18288099, 36334246, 37810884
Hyperparathyroidism Primary	Associate	35323929, 36334246, 37810884
Hyperplasia	Associate	15061869, 17710155, 9033255
Hypersensitivity Delayed	Associate	23505216
Hypertension	Stimulate	35439345
Hyperthyroidism	Associate	37876543
Hypoxia	Stimulate	24860972
Hypoxia Brain	Associate	20565904
Ileal Diseases	Associate	35922826
Inflammatory Breast Neoplasms	Associate	20503407
Intervertebral Disc Degeneration	Associate	30984546
Kidney Neoplasms	Associate	15357873
Kuskokwim disease	Associate	21289244
Laryngeal Diseases	Associate	15646812
Leiomyoma	Associate	31159158
Leukemia	Associate	11035070, 19657571, 21418583, 22142798, 35738638, 39519258, 39950487, 9746784
Leukemia Hairy Cell	Associate	26065650, 26294716, 28801450
Leukemia Lymphocytic Chronic B Cell	Associate	18922614, 21478095, 39519258, 39950487, 9616167
Leukemia Lymphoma Adult T Cell	Associate	7655021
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15833859, 20200561, 24098519, 26956626, 30575920
Leukemia Myeloid	Associate	15746092, 19221487
Leukemia Myeloid Acute	Associate	14525786, 15289327, 21084834, 21422114, 25213837, 26053097, 28522571
Leukemia Promyelocytic Acute	Associate	10090931, 16195327
Lichen Sclerosus et Atrophicus	Inhibit	16474380
Liver Cirrhosis	Associate	16052694
Lung Neoplasms	Associate	22848476, 25851349, 27802291, 30375484, 36224313
Lupus Erythematosus Systemic	Associate	17608810, 33982894
Lymphatic Metastasis	Associate	15743689, 17685465, 22114462
Lymphoma	Associate	10424746, 12780788, 9212741
Lymphoma	Inhibit	10983687
Lymphoma AIDS Related	Associate	12107101
Lymphoma B Cell	Associate	10397744, 10424746, 12780788, 15665120
Lymphoma B Cell Marginal Zone	Associate	17058805
Lymphoma Large B Cell Diffuse	Associate	10424746, 12107101, 18287131, 9212741
Lymphoma Large Cell Anaplastic	Associate	22488797
Lymphoma Mantle Cell	Associate	11035575, 12351407, 12515730, 16645163, 26022239, 32584970
Lymphoma Mantle Cell	Inhibit	9665478
Lymphoma Non Hodgkin	Associate	10354138, 10622539, 18285702, 7655021
Lymphoma Primary Effusion	Associate	10751346, 15271792, 20074295
Lymphoma T Cell	Associate	21045237
Lymphoma T Cell Cutaneous	Associate	29599065
Lymphoma T Cell Peripheral	Associate	21045237
Malformations of Cortical Development Group I	Associate	18922614
Melanoma	Associate	10594749, 10944199, 11415463, 21336261, 22970236, 28231799, 28762556, 9665492
Meningioma	Associate	26762354
Microsatellite Instability	Inhibit	17086168
Microsatellite Instability	Associate	21336261
Mouth Diseases	Inhibit	10711250
Mouth Neoplasms	Inhibit	9466585
Multiple Endocrine Neoplasia	Associate	17710155, 20824794, 21289244, 23505216, 23555276, 26762354, 32232325, 35323929, 36334246
Multiple Endocrine Neoplasia Type 1	Associate	15640349, 18288099, 20616437, 21289244, 25824098, 29036195, 32232325, 38244045
Multiple Endocrine Neoplasia Type 2a	Associate	32761341
Multiple Myeloma	Inhibit	11278272
Multiple Myeloma	Associate	16188652, 17303695, 22142798, 27319807
Myocardial Infarction	Associate	15061869, 17351341
Myositis	Associate	12707036
Nasopharyngeal Carcinoma	Associate	30950204
Necrosis	Associate	19735566
Neoplasm Invasiveness	Inhibit	16474380, 21683992
Neoplasm Invasiveness	Associate	9736039
Neoplasm Metastasis	Inhibit	10711250
Neoplasm Metastasis	Associate	19035293, 21594709, 26908328, 31294654, 31969336, 32374727, 34454403, 35504904, 37954063
Neoplasm Recurrence Local	Associate	34326338
Neoplasms	Associate	10397744, 10576664, 10948161, 11106243, 11830494, 11920465, 12359053, 12700233, 12824885, 14645699, 14669271, 14760081, 15073847, 15526363, 15588951 View all (67 more)
Neoplasms	Inhibit	10437789, 10514396, 11474127, 11520803, 12351407, 12698196, 12890807, 15390183, 15743786, 16619581, 16710719, 17569667, 17721077, 18246048, 18756055 View all (28 more)
Neoplasms	Stimulate	11279018, 20306451
Neoplasms Basal Cell	Associate	18922157, 26008974
Neoplasms Squamous Cell	Associate	19924135
Neuroblastoma	Associate	15390183, 23440295, 25264277, 28246384, 28667701, 31863533
Neurodevelopmental Disorders	Associate	23505216
Neuroendocrine Tumors	Associate	24185511, 27802291, 30219970, 33140857, 33509126, 34326338, 35323929
Nevus Pigmented	Associate	15154004, 21336261, 22970236
Niemann Pick Disease Type C	Associate	28061788
Non functioning pancreatic endocrine tumor	Associate	17710155
Non Muscle Invasive Bladder Neoplasms	Inhibit	12073046
Oligodendroglioma	Associate	11419973
Optic Neuropathy Ischemic	Associate	15061869
Osteosarcoma	Associate	22158041, 30992462, 33960434
Ovarian Neoplasms	Associate	12853350, 15075339, 17409409, 25926381, 26213845, 26320455, 28122348, 30769778, 33801209, 35941978, 9155043, 9916926
Ovarian Neoplasms	Inhibit	17409409
Pancreatic Diseases	Associate	23555276
Pancreatic Intraductal Neoplasms	Associate	25084021
Pancreatic Neoplasms	Associate	16086840, 16951171, 18980972, 19910837, 21909380, 23393547, 23555276, 25027401
Pancreatic Neoplasms	Inhibit	22293850
Parathyroid Neoplasms	Associate	21289244, 23715670, 26762354, 33316141, 38244045, 9033255
Personality Disorders	Associate	25824098
Pituitary ACTH Hypersecretion	Associate	32232325
Pituitary Adenoma Familial Isolated	Associate	22291433
Pituitary Neoplasms	Associate	22291433, 23555276, 25494863, 35323929, 9250163, 9365157
Polycystic Ovary Syndrome	Associate	32729067
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	17008550
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	10935480
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17008550, 26919107, 8605354
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	10935480
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11520803, 15353558
Primary Ovarian Insufficiency	Associate	21575944
Prostatic Hyperplasia	Associate	9736039
Prostatic Neoplasms	Associate	10576664, 15798096, 16097446, 17522055, 18415709, 18687691, 20053773, 21182779, 21932423, 26636522, 27268646, 28212547, 29892016, 31969336, 32763409, 35430569, 36360276, 37239316, 9927492 View all (4 more)
Prostatic Neoplasms Castration Resistant	Associate	29206995
Prostatitis	Associate	10488120, 10840458, 11943705, 12707036, 17569667, 9927492
Pterygium	Associate	17179165, 25053875
Renal Insufficiency Chronic	Inhibit	18288099
Reperfusion Injury	Associate	28334711
Retinal Dysplasia	Inhibit	9466585
Retinoblastoma	Inhibit	19843869
Retinoblastoma	Associate	26730174
Rhabdoid Tumor	Associate	20212451
Rhabdomyosarcoma Embryonal	Associate	12359053
Rupture	Stimulate	26451018
Sarcoma	Associate	12824885
Sarcoma Ewing	Associate	18271016
Sezary Syndrome	Associate	26551667
Simpson Golabi Behmel syndrome	Associate	23505216
Small Cell Lung Carcinoma	Associate	26008974, 9421477
Squamous Cell Carcinoma of Head and Neck	Associate	16619581, 16740156, 17217620, 20805359, 28338203, 33664437
Squamous Intraepithelial Lesions	Inhibit	10711250
Status Asthmaticus	Associate	31685437
Stomach Neoplasms	Associate	10948161, 12149143, 17483253, 17722244, 21439087, 26470770, 27099442, 9310133, 9741540
Stroke	Associate	15061869
T Lymphocytopenia Idiopathic CD4 Positive	Associate	22454463
Tachycardia Atrioventricular Nodal Reentry	Associate	15627896
Tertiary Lymphoid Structures	Associate	17685465
Thymus Neoplasms	Associate	35323929
Thyroid Cancer Papillary	Associate	17685465, 19461157, 26762354, 27314298, 31298336
Thyroid Carcinoma Anaplastic	Associate	25576899
Thyroid Neoplasms	Associate	15743786, 25576899
Thyroid Nodule	Associate	17728499
Triple Negative Breast Neoplasms	Associate	31033460, 33227964, 34326372, 35504904
Upton Young syndrome	Associate	25307738
Urinary Bladder Neoplasms	Associate	25536625
Uterine Cervical Dysplasia	Inhibit	16474380
Uterine Cervical Neoplasms	Inhibit	10711250, 15710386
Uterine Cervical Neoplasms	Associate	24423924, 35439960, 38112461
Uveal melanoma	Associate	22653968
Vascular System Injuries	Associate	23312942
Vulvar Neoplasms	Inhibit	16474380
Wilms Tumor	Associate	14760081, 21594709
Xeroderma Pigmentosum Complementation Group C	Inhibit	12485438

CDKN1B (cyclin dependent kinase inhibitor 1B)