Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1003
Gene name	Cadherin 5
Gene symbol	CDH5
Synonyms (NCBI Gene)	7B4CD144
Chromosome	16
Chromosome location	16q21
Summary	This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT017265	hsa-miR-335-5p	Microarray	18185580
MIRT021947	hsa-miR-128-3p	Microarray	17612493
MIRT029178	hsa-miR-26b-5p	Microarray	19088304
MIRT052977	hsa-miR-125b-5p	qRT-PCRWestern blot	22391569
MIRT053051	hsa-miR-101-3p	Luciferase reporter assayWestern blot	23554480
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT732198	mmu-miR-27a-3p	ChIP-seqImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26980408
MIRT732198	mmu-miR-27a-3p	ChIP-seqImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26980408
MIRT734215	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blotting	33274193
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT756298	hsa-miR-125a-5p	Luciferase reporter assayImmunofluorescence	35401562
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT879865	hsa-miR-759	CLIP-seq
MIRT1556161	hsa-miR-1294	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1556163	hsa-miR-4436a	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq
MIRT1960720	hsa-miR-1273g	CLIP-seq
MIRT1960721	hsa-miR-2110	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1960723	hsa-miR-3151	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1960724	hsa-miR-486-3p	CLIP-seq
MIRT1960725	hsa-miR-541	CLIP-seq
MIRT1960726	hsa-miR-654-5p	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT2197357	hsa-miR-103a	CLIP-seq
MIRT2197358	hsa-miR-107	CLIP-seq
MIRT2197359	hsa-miR-1184	CLIP-seq
MIRT2197360	hsa-miR-1205	CLIP-seq
MIRT2197361	hsa-miR-1587	CLIP-seq
MIRT2197362	hsa-miR-1909	CLIP-seq
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT2197363	hsa-miR-3179	CLIP-seq
MIRT2197364	hsa-miR-378g	CLIP-seq
MIRT2197365	hsa-miR-4492	CLIP-seq
MIRT2197366	hsa-miR-4498	CLIP-seq
MIRT2197367	hsa-miR-4505	CLIP-seq
MIRT2197368	hsa-miR-4656	CLIP-seq
MIRT2197369	hsa-miR-4667-5p	CLIP-seq
MIRT2197370	hsa-miR-4675	CLIP-seq
MIRT2197371	hsa-miR-4700-5p	CLIP-seq
MIRT2197372	hsa-miR-4731-5p	CLIP-seq
MIRT2197373	hsa-miR-4741	CLIP-seq
MIRT2197374	hsa-miR-622	CLIP-seq
MIRT2197375	hsa-miR-661	CLIP-seq
MIRT2197376	hsa-miR-762	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ERG	Unknown	19359602
KLF4	Activation	20724706

Show/Hide all (85)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0001886	Process	Endothelial cell morphogenesis	IEA
GO:0001886	Process	Endothelial cell morphogenesis	ISS
GO:0001955	Process	Blood vessel maturation	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IPI	12088286
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15985432, 17057644, 18287330, 18662404, 20010843, 20123964, 20332120, 21183689, 26923917, 28514442, 33961781, 39232006
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IDA	25978380
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9219219
GO:0005911	Component	Cell-cell junction	IDA	15572031, 19996314, 20332120, 21168935, 23288152
GO:0005911	Component	Cell-cell junction	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	25978380, 26598555, 27338829
GO:0005912	Component	Adherens junction	IEA
GO:0005912	Component	Adherens junction	IMP	26923917
GO:0005912	Component	Adherens junction	ISS
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	23159740
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007043	Process	Cell-cell junction assembly	IMP	23288152
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	TAS	9219219
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	23159740
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	21168935
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IPI	18287330
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	23288152
GO:0010628	Process	Positive regulation of gene expression	IMP	26598555
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9219219
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0019903	Function	Protein phosphatase binding	IBA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	28926625
GO:0030054	Component	Cell junction	IEA
GO:0030054	Component	Cell junction	ISS
GO:0030159	Function	Signaling receptor complex adaptor activity	IMP	11950700
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030513	Process	Positive regulation of BMP signaling pathway	IMP	26598555
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	23159740
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	26598555
GO:0031965	Component	Nuclear membrane	IDA
GO:0034332	Process	Adherens junction organization	IBA
GO:0034332	Process	Adherens junction organization	IDA	26598555
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0043114	Process	Regulation of vascular permeability	IDA	23159740, 26598555
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25893857
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043534	Process	Blood vessel endothelial cell migration	IMP	31934175
GO:0044325	Function	Transmembrane transporter binding	IPI	19996314
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	26598555
GO:0045296	Function	Cadherin binding	IBA
GO:0045766	Process	Positive regulation of angiogenesis	IGI	22391569
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IGI	28112401
GO:0070051	Function	Fibrinogen binding	IMP	19413351
GO:0070161	Component	Anchoring junction	IEA
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070830	Process	Bicellular tight junction assembly	IMP	25753039
GO:0071944	Component	Cell periphery	IEA
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	ISS
GO:1902396	Process	Protein localization to bicellular tight junction	IMP	25753039
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	23159740
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IMP	23288152
GO:1990782	Function	Protein tyrosine kinase binding	IPI	11950700
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	20332120
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	31934175

MIM	HGNC	e!Ensembl
601120	1764	ENSG00000179776

P33151

Protein name

Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)

Protein function

Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed:212

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	52 → 142	Cadherin domain	Domain
PF00028	Cadherin	156 → 249	Cadherin domain	Domain
PF00028	Cadherin	263 → 364	Cadherin domain	Domain
PF00028	Cadherin	377 → 470	Cadherin domain	Domain
PF00028	Cadherin	483 → 576	Cadherin domain	Domain
PF01049	Cadherin_C	621 → 777	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells (at protein level) (PubMed:27338829). Expressed in the brain (PubMed:2059658). {ECO:0000269|PubMed:2059658, ECO:0000269|PubMed:27338829}.

Sequence

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY

Sequence length

784

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Lung cancer	Uncertain significance	rs139612718	RCV005927814
Marfanoid habitus and intellectual disability	Uncertain significance	rs1596937199	RCV000850465

Show/Hide Text Mining Associations (108)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	26683690
Adenocarcinoma of Lung	Associate	33062704, 33661044, 33728331, 35242247, 35635202, 36529788
Adenomatous Polyposis Coli	Associate	33108070
Alveolar capillary dysplasia	Associate	38029923
Antiphospholipid Syndrome	Stimulate	11937138
Antiphospholipid Syndrome	Associate	38155384
Aphasia Conduction	Associate	40065360
Arthritis Juvenile	Associate	33144896
Arthritis Rheumatoid	Associate	21905018
Atrioventricular Block	Associate	39354406
Autism Spectrum Disorder	Associate	32807774
Bacterial Infections	Stimulate	34112226
Bone Resorption	Associate	25278075
Breast Neoplasms	Associate	18628953, 20386594, 27693459, 33899544, 34205118
Breast Neoplasms	Inhibit	9434630
Capillary Leak Syndrome	Associate	24885155
Carcinogenesis	Associate	33108070, 34358255
Carcinoma Adenoid Cystic	Associate	30945361
Carcinoma Hepatocellular	Associate	33118329
Carcinoma Non Small Cell Lung	Associate	23369236
Carcinoma Renal Cell	Associate	20121140, 34358255, 36138026
Cardiomyopathy Dilated	Inhibit	29115553
Cardiovascular Diseases	Associate	32119531
Carotid Artery Diseases	Associate	14532881
Carotid Stenosis	Associate	14532881
Central Serous Chorioretinopathy	Associate	35052395
Chemical and Drug Induced Liver Injury	Stimulate	27224670
Constriction Pathologic	Associate	14532881
Corneal Endothelial Cell Loss	Associate	32792588
Coronary Artery Disease	Associate	18420943
COVID 19	Inhibit	33578631
Dental Plaque	Associate	14532881
Depressive Disorder	Inhibit	40170649
Diabetes Mellitus	Associate	26069241
Diabetes Mellitus	Stimulate	27838104
Diabetic Retinopathy	Associate	30988072
Embryo Loss	Associate	11238107
Esophageal Squamous Cell Carcinoma	Associate	37766459
Exfoliation Syndrome	Associate	38287276
Fibrosis	Associate	34522168
Glaucoma Open Angle	Associate	37340071
Glioblastoma	Associate	23029099, 23543272, 24868550
Glioma	Associate	23543272
Glucosephosphate Dehydrogenase Deficiency	Associate	19008126, 26360820
Granuloma	Associate	19037921
Hantavirus Pulmonary Syndrome	Associate	20810734
Hemangioma Cavernous Central Nervous System	Stimulate	20809761
Hematoma Subdural Chronic	Associate	38030262
Hemolytic Uremic Syndrome	Inhibit	30301260
Hemorrhage	Associate	20809761
Hereditary leiomyomatosis and renal cell cancer	Associate	37910143
HIV Infections	Associate	23554480
Hodgkin Disease	Associate	37910143
Hypoxia	Stimulate	23543272, 30945361
Hypoxia	Inhibit	27627890, 33326735
Hypoxia	Associate	33737411
Idiopathic Pulmonary Fibrosis	Associate	34522168
Impotence Vasculogenic	Associate	31936664, 36418859
Infarction	Associate	14532881
Inflammation	Associate	14532881, 19037921, 36761747, 38155384
Inflammation	Stimulate	30214039
Intracranial Arteriovenous Malformations	Associate	36934253
Laryngeal Diseases	Associate	35462765
Leukemia	Associate	17638851
Liver Diseases	Associate	40065360
Lung Neoplasms	Associate	33728331
Lymphatic Metastasis	Associate	23089909
Lymphoma	Associate	34166375
Melanoma	Associate	11416160, 16481735, 20181932, 25447529, 26504080
Melanoma	Inhibit	27234159
Mouth Diseases	Associate	32363797
Mucolipidoses	Associate	32363797
Multiple Sclerosis Relapsing Remitting	Inhibit	32386505
Neoplasm Metastasis	Associate	29786069, 34358255
Neoplasm Metastasis	Inhibit	33728331
Neoplasms	Associate	11238107, 17638851, 23543272, 24868550, 26504080, 26868378, 27798235, 29949786, 31619190, 33108070, 34205118, 36138026, 37587724, 37766459, 37809080, 9434630 View all (1 more)
O'Donnell Pappas syndrome	Associate	38634365
Osteoarthritis	Associate	31257478
Osteosarcoma	Associate	19760520
Ovarian Diseases	Associate	29192416
Ovarian Neoplasms	Associate	29192416
Pain	Associate	34608709
Periodic fever familial autosomal dominant	Inhibit	39337254
Polycystic Ovary Syndrome	Associate	29206944
Polyps	Associate	33108070
Pre Eclampsia	Associate	34153378
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17638851
Prostatic Neoplasms	Associate	31936664, 35163245, 36418859
Prostatitis	Associate	26636522
Pulmonary Arterial Hypertension	Associate	32813135
Pulmonary Disease Chronic Obstructive	Associate	36899372
Reperfusion Injury	Associate	29542225, 32846824
Sarcoidosis	Associate	27259755
Sarcoma Kaposi	Associate	15855650, 27798235
Schizophrenia	Associate	30214039
Scleroderma Systemic	Associate	18197262, 26360820
Sleep Apnea Obstructive	Associate	33737411
Sleep Apnea Syndromes	Associate	33737411
Spondylitis Ankylosing	Associate	38634365
Squamous Cell Carcinoma of Head and Neck	Associate	29949786
ST Elevation Myocardial Infarction	Associate	34360827
Stomach Neoplasms	Associate	23089909, 37587724
Temporomandibular Joint Dysfunction Syndrome	Associate	31340134
Thrombocythemia Essential	Associate	19508974
Uremia	Associate	30301260
Urinary Bladder Neoplasms	Inhibit	37809080
Vascular Diseases	Associate	33144896
Virus Diseases	Inhibit	35709328

CDH5 (cadherin 5)