Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1003
Gene name Gene Name - the full gene name approved by the HGNC.	Cadherin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDH5
Synonyms (NCBI Gene) Gene synonyms aliases	7B4, CD144
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT006257	hsa-miR-211-5p	Luciferase reporter assay	22235338
MIRT017265	hsa-miR-335-5p	Microarray	18185580
MIRT021947	hsa-miR-128-3p	Microarray	17612493
MIRT029178	hsa-miR-26b-5p	Microarray	19088304
MIRT052977	hsa-miR-125b-5p	qRT-PCR, Western blot	22391569
MIRT053051	hsa-miR-101-3p	Luciferase reporter assay, Western blot	23554480
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT732198	mmu-miR-27a-3p	ChIP-seq, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26980408
MIRT732198	mmu-miR-27a-3p	ChIP-seq, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26980408
MIRT734215	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33274193
MIRT710488	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT710487	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT710486	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT710485	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT710484	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT710483	hsa-miR-4512	HITS-CLIP	19536157
MIRT710482	hsa-miR-4761-5p	HITS-CLIP	19536157
MIRT710481	hsa-miR-3918	HITS-CLIP	19536157
MIRT710480	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT710479	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT710478	hsa-miR-4772-3p	HITS-CLIP	19536157
MIRT710477	hsa-miR-2276-3p	HITS-CLIP	19536157
MIRT710476	hsa-miR-4708-3p	HITS-CLIP	19536157
MIRT710475	hsa-miR-6132	HITS-CLIP	19536157
MIRT710474	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT710473	hsa-miR-4297	HITS-CLIP	19536157
MIRT710472	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT710471	hsa-miR-1207-5p	HITS-CLIP	19536157
MIRT710470	hsa-miR-4763-3p	HITS-CLIP	19536157
MIRT710469	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT710468	hsa-miR-544a	HITS-CLIP	19536157
MIRT756298	hsa-miR-125a-5p	Luciferase reporter assay, Immunofluorescence	35401562
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT879865	hsa-miR-759	CLIP-seq
MIRT1556161	hsa-miR-1294	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1556163	hsa-miR-4436a	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq
MIRT1960720	hsa-miR-1273g	CLIP-seq
MIRT1960721	hsa-miR-2110	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1960723	hsa-miR-3151	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT1960724	hsa-miR-486-3p	CLIP-seq
MIRT1960725	hsa-miR-541	CLIP-seq
MIRT1960726	hsa-miR-654-5p	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT2197357	hsa-miR-103a	CLIP-seq
MIRT2197358	hsa-miR-107	CLIP-seq
MIRT2197359	hsa-miR-1184	CLIP-seq
MIRT2197360	hsa-miR-1205	CLIP-seq
MIRT2197361	hsa-miR-1587	CLIP-seq
MIRT2197362	hsa-miR-1909	CLIP-seq
MIRT879864	hsa-miR-2355-5p	CLIP-seq
MIRT1960722	hsa-miR-3150a-3p	CLIP-seq
MIRT1556162	hsa-miR-3175	CLIP-seq
MIRT2197363	hsa-miR-3179	CLIP-seq
MIRT2197364	hsa-miR-378g	CLIP-seq
MIRT2197365	hsa-miR-4492	CLIP-seq
MIRT2197366	hsa-miR-4498	CLIP-seq
MIRT2197367	hsa-miR-4505	CLIP-seq
MIRT2197368	hsa-miR-4656	CLIP-seq
MIRT2197369	hsa-miR-4667-5p	CLIP-seq
MIRT2197370	hsa-miR-4675	CLIP-seq
MIRT2197371	hsa-miR-4700-5p	CLIP-seq
MIRT2197372	hsa-miR-4731-5p	CLIP-seq
MIRT2197373	hsa-miR-4741	CLIP-seq
MIRT2197374	hsa-miR-622	CLIP-seq
MIRT2197375	hsa-miR-661	CLIP-seq
MIRT2197376	hsa-miR-762	CLIP-seq
MIRT1960727	hsa-miR-939	CLIP-seq
MIRT1556164	hsa-miR-711	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ERG	Unknown	19359602
KLF4	Activation	20724706

Show/Hide all(61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA	21873635
GO:0001932	Process	Regulation of protein phosphorylation	IDA	23159740
GO:0001944	Process	Vasculature development	IBA	21873635
GO:0001955	Process	Blood vessel maturation	IEA
GO:0005102	Function	Signaling receptor binding	IPI	12088286
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15985432, 17057644, 18287330, 18662404, 20010843, 20123964, 20332120, 21183689, 26923917, 28514442
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	25978380
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	15572031, 19996314, 20332120, 21168935, 23288152
GO:0005912	Component	Adherens junction	IBA	21873635
GO:0005912	Component	Adherens junction	IDA	25978380, 26598555
GO:0005912	Component	Adherens junction	IMP	26923917
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	23159740
GO:0007043	Process	Cell-cell junction assembly	IBA	21873635
GO:0007043	Process	Cell-cell junction assembly	IMP	23288152
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	21168935
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0008013	Function	Beta-catenin binding	IPI	18287330
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	23288152
GO:0010628	Process	Positive regulation of gene expression	IMP	26598555
GO:0016020	Component	Membrane	TAS	9219219
GO:0016021	Component	Integral component of membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	21873635
GO:0016342	Component	Catenin complex	IBA	21873635
GO:0019903	Function	Protein phosphatase binding	IPI	28926625
GO:0030054	Component	Cell junction	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	15572031
GO:0030513	Process	Positive regulation of BMP signaling pathway	IMP	26598555
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	23159740
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	26598555
GO:0031965	Component	Nuclear membrane	IDA
GO:0034332	Process	Adherens junction organization	IBA	21873635
GO:0034332	Process	Adherens junction organization	IDA	26598555
GO:0034332	Process	Adherens junction organization	TAS
GO:0035307	Process	Positive regulation of protein dephosphorylation	IMP	11950700
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0043114	Process	Regulation of vascular permeability	IDA	26598555
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	25893857
GO:0043534	Process	Blood vessel endothelial cell migration	IMP	31934175
GO:0044325	Function	Ion channel binding	IPI	19996314
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IDA	26598555
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0045766	Process	Positive regulation of angiogenesis	IGI	22391569
GO:0050728	Process	Negative regulation of inflammatory response	IGI	28112401
GO:0070051	Function	Fibrinogen binding	IMP	19413351
GO:0070700	Function	BMP receptor binding	IPI	26598555
GO:0070830	Process	Bicellular tight junction assembly	IMP	25753039
GO:0098609	Process	Cell-cell adhesion	IDA	15572031
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA	21873635
GO:1902396	Process	Protein localization to bicellular tight junction	IMP	25753039
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IMP	23288152
GO:1990782	Function	Protein tyrosine kinase binding	IPI	11950700
GO:2000114	Process	Regulation of establishment of cell polarity	IBA	21873635
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	20332120
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	31934175

MIM	HGNC	e!Ensembl
601120	1764	ENSG00000179776

Protein

UniProt ID

P33151

Protein name

Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)

Protein function

Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed:212

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	52 → 142	Cadherin domain	Domain
PF00028	Cadherin	156 → 249	Cadherin domain	Domain
PF00028	Cadherin	263 → 364	Cadherin domain	Domain
PF00028	Cadherin	377 → 470	Cadherin domain	Domain
PF00028	Cadherin	483 → 576	Cadherin domain	Domain
PF01049	Cadherin_C	621 → 777	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells (at protein level) (PubMed:27338829). Expressed in the brain (PubMed:2059658). {ECO:0000269|PubMed:2059658, ECO:0000269|PubMed:27338829}.

Sequence

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY

Sequence length

784

Interactions

View interactions

CDH5 (cadherin 5)