Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	948
Gene name	CD36 molecule (CD36 blood group)
Gene symbol	CD36
Synonyms (NCBI Gene)	BDPLT10CHDS7FATGP3BGP4GPIVPASIVSCARB3
Chromosome	7
Chromosome location	7q21.11
Summary	The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhes

Show/Hide all (20)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1049673	C>G,T	Risk-factor	3 prime UTR variant, genic downstream transcript variant
rs1527483	G>A	Risk-factor	Intron variant
rs1761667	G>A	Risk-factor	Genic upstream transcript variant, intron variant
rs1984112	A>C,G,T	Risk-factor	Genic upstream transcript variant, intron variant
rs3211893	T>A,C,G	Likely-pathogenic	Splice donor variant
rs3211938	T>G	Risk-factor, pathogenic, benign	Coding sequence variant, stop gained, intron variant
rs70961716	AAAA>-,AAAAA	Likely-pathogenic	Frameshift variant, intron variant, coding sequence variant
rs75326924	C>T	Pathogenic	Intron variant, 5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant
rs121918035	A>C,G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs142186404	T>C,G	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs148051111	G>A,C	Likely-pathogenic, uncertain-significance	Splice donor variant
rs148910227	C>G,T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs550565800	ATTGTGCCTATT>-,ATTGTGCCTATTGTGCCTATT	Pathogenic-likely-pathogenic	Inframe deletion, inframe insertion, coding sequence variant, non coding transcript variant
rs551607784	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs572295823	CA>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant, non coding transcript variant
rs765809606	A>-,AA	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs766920034	->C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, frameshift variant
rs771061715	AATAA>-	Likely-pathogenic	Non coding transcript variant, terminator codon variant, frameshift variant
rs1064795310	G>C	Likely-pathogenic	Splice acceptor variant
rs1064795836	G>C	Likely-pathogenic	Splice donor variant

293

Show/Hide all (293)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018933	hsa-miR-335-5p	Microarray	18185580
MIRT021050	hsa-miR-155-5p	Proteomics;Other	20584899
MIRT030109	hsa-miR-26b-5p	Microarray	19088304
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT616399	hsa-miR-8064	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23313552
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT671345	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT616399	hsa-miR-8064	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT609641	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT575268	hsa-miR-448	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575270	hsa-miR-455-5p	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575269	hsa-miR-8064	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT575271	hsa-miR-8485	HITS-CLIP	27418678
MIRT732664	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	33517563
MIRT732664	hsa-miR-145-5p	Luciferase reporter assayqRT-PCR	33517563
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575269	hsa-miR-8064	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23313552
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575270	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575269	hsa-miR-8064	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT613543	hsa-miR-4495	HITS-CLIP	23824327
MIRT613542	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT575271	hsa-miR-8485	HITS-CLIP	23824327
MIRT514954	hsa-miR-4438	PAR-CLIP	23446348
MIRT514953	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT514952	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514951	hsa-miR-1254	PAR-CLIP	23446348
MIRT514950	hsa-miR-3116	PAR-CLIP	23446348
MIRT514949	hsa-miR-661	PAR-CLIP	23446348
MIRT514948	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT514946	hsa-miR-5095	PAR-CLIP	23446348
MIRT514947	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514945	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514944	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT875166	hsa-miR-146a	CLIP-seq
MIRT875167	hsa-miR-146b-5p	CLIP-seq
MIRT875168	hsa-miR-155	CLIP-seq
MIRT875169	hsa-miR-197	CLIP-seq
MIRT875170	hsa-miR-1972	CLIP-seq
MIRT875171	hsa-miR-1976	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT875173	hsa-miR-3129-3p	CLIP-seq
MIRT875174	hsa-miR-3163	CLIP-seq
MIRT875175	hsa-miR-3173-3p	CLIP-seq
MIRT875176	hsa-miR-338-5p	CLIP-seq
MIRT875177	hsa-miR-3529	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT875179	hsa-miR-379	CLIP-seq
MIRT875180	hsa-miR-3942-3p	CLIP-seq
MIRT875181	hsa-miR-3975	CLIP-seq
MIRT875182	hsa-miR-4266	CLIP-seq
MIRT875183	hsa-miR-4320	CLIP-seq
MIRT875184	hsa-miR-4328	CLIP-seq
MIRT875185	hsa-miR-4428	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875187	hsa-miR-4451	CLIP-seq
MIRT875188	hsa-miR-4536	CLIP-seq
MIRT875189	hsa-miR-4633-3p	CLIP-seq
MIRT875190	hsa-miR-4650-3p	CLIP-seq
MIRT875191	hsa-miR-4666-3p	CLIP-seq
MIRT875192	hsa-miR-4691-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875194	hsa-miR-4695-5p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT875197	hsa-miR-4729	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT875199	hsa-miR-4796-3p	CLIP-seq
MIRT875200	hsa-miR-4797-5p	CLIP-seq
MIRT875201	hsa-miR-4803	CLIP-seq
MIRT875202	hsa-miR-5096	CLIP-seq
MIRT875203	hsa-miR-520g	CLIP-seq
MIRT875204	hsa-miR-520h	CLIP-seq
MIRT875205	hsa-miR-548n	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875207	hsa-miR-548t	CLIP-seq
MIRT875208	hsa-miR-577	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT875210	hsa-miR-640	CLIP-seq
MIRT875211	hsa-miR-651	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq
MIRT875213	hsa-miR-765	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT1959476	hsa-miR-2355-3p	CLIP-seq
MIRT1959477	hsa-miR-3121-5p	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT1959479	hsa-miR-3199	CLIP-seq
MIRT1959480	hsa-miR-3647-3p	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT1959483	hsa-miR-450b-5p	CLIP-seq
MIRT1959484	hsa-miR-4652-3p	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT1959486	hsa-miR-4740-3p	CLIP-seq
MIRT1959487	hsa-miR-4766-5p	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT1959489	hsa-miR-676	CLIP-seq
MIRT875165	hsa-miR-1193	CLIP-seq
MIRT1959473	hsa-miR-1207-3p	CLIP-seq
MIRT1959474	hsa-miR-122	CLIP-seq
MIRT1959475	hsa-miR-1226	CLIP-seq
MIRT2196457	hsa-miR-1915	CLIP-seq
MIRT2196458	hsa-miR-2115	CLIP-seq
MIRT875172	hsa-miR-2392	CLIP-seq
MIRT1959478	hsa-miR-3135b	CLIP-seq
MIRT2196459	hsa-miR-3155	CLIP-seq
MIRT2196460	hsa-miR-3155b	CLIP-seq
MIRT1959481	hsa-miR-3652	CLIP-seq
MIRT2196461	hsa-miR-4264	CLIP-seq
MIRT2196462	hsa-miR-4277	CLIP-seq
MIRT2196463	hsa-miR-4420	CLIP-seq
MIRT1959482	hsa-miR-4430	CLIP-seq
MIRT875186	hsa-miR-4435	CLIP-seq
MIRT875193	hsa-miR-4695-3p	CLIP-seq
MIRT875195	hsa-miR-4701-5p	CLIP-seq
MIRT875196	hsa-miR-4716-5p	CLIP-seq
MIRT2196464	hsa-miR-4726-3p	CLIP-seq
MIRT1959485	hsa-miR-4733-3p	CLIP-seq
MIRT2196465	hsa-miR-4772-3p	CLIP-seq
MIRT875198	hsa-miR-4781-3p	CLIP-seq
MIRT2196466	hsa-miR-4797-3p	CLIP-seq
MIRT2196467	hsa-miR-484	CLIP-seq
MIRT2196468	hsa-miR-516a-3p	CLIP-seq
MIRT2196469	hsa-miR-539	CLIP-seq
MIRT875206	hsa-miR-548s	CLIP-seq
MIRT875209	hsa-miR-588	CLIP-seq
MIRT1959488	hsa-miR-646	CLIP-seq
MIRT2385741	hsa-miR-128	CLIP-seq
MIRT2385742	hsa-miR-140-3p	CLIP-seq
MIRT2385743	hsa-miR-148a	CLIP-seq
MIRT2385744	hsa-miR-148b	CLIP-seq
MIRT2385745	hsa-miR-152	CLIP-seq
MIRT2446587	hsa-miR-3156-5p	CLIP-seq
MIRT2446588	hsa-miR-3200-5p	CLIP-seq
MIRT2446589	hsa-miR-339-5p	CLIP-seq
MIRT2446590	hsa-miR-4477a	CLIP-seq
MIRT2446591	hsa-miR-4682	CLIP-seq
MIRT2446592	hsa-miR-4742-3p	CLIP-seq
MIRT2499480	hsa-miR-1228	CLIP-seq
MIRT2499481	hsa-miR-1263	CLIP-seq
MIRT2499482	hsa-miR-1269	CLIP-seq
MIRT2499483	hsa-miR-1269b	CLIP-seq
MIRT2499484	hsa-miR-203	CLIP-seq
MIRT2499485	hsa-miR-223	CLIP-seq
MIRT2499486	hsa-miR-329	CLIP-seq
MIRT2499487	hsa-miR-362-3p	CLIP-seq
MIRT875178	hsa-miR-374c	CLIP-seq
MIRT2499488	hsa-miR-3941	CLIP-seq
MIRT2499489	hsa-miR-4529-3p	CLIP-seq
MIRT2499490	hsa-miR-4697-3p	CLIP-seq
MIRT2499491	hsa-miR-4760-3p	CLIP-seq
MIRT2499492	hsa-miR-548a-3p	CLIP-seq
MIRT2499493	hsa-miR-548ae	CLIP-seq
MIRT2499494	hsa-miR-548aj	CLIP-seq
MIRT2499495	hsa-miR-548am	CLIP-seq
MIRT2499496	hsa-miR-548e	CLIP-seq
MIRT2499497	hsa-miR-548f	CLIP-seq
MIRT2499498	hsa-miR-548x	CLIP-seq
MIRT2499499	hsa-miR-603	CLIP-seq
MIRT875212	hsa-miR-655	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
PPARA	Unknown	16713233;20110263
PPARG	Activation	11795270
PPARG	Unknown	15104237;17322100
RUNX3	Repression	16887969

179

Show/Hide all (179)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000165	Process	MAPK cascade	IEA
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001540	Function	Amyloid-beta binding	IDA	29518356
GO:0001540	Function	Amyloid-beta binding	TAS	20037584
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	17416590
GO:0002532	Process	Production of molecular mediator involved in inflammatory response	TAS	29111364
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IMP	10772654
GO:0005041	Function	Low-density lipoprotein particle receptor activity	TAS	9568716
GO:0005044	Function	Scavenger receptor activity	IBA
GO:0005044	Function	Scavenger receptor activity	IMP	18941241
GO:0005044	Function	Scavenger receptor activity	TAS	11240025, 29111364
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	16880211, 18773118, 20037584, 23640500, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	22022213, 24503477
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2468669, 9568716
GO:0005901	Component	Caveola	IBA
GO:0006629	Process	Lipid metabolic process	NAS	7518447
GO:0006631	Process	Fatty acid metabolic process	TAS	29111364
GO:0006869	Process	Lipid transport	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IBA
GO:0006898	Process	Receptor-mediated endocytosis	IMP	18941241
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006911	Process	Phagocytosis, engulfment	TAS	29111364
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2468670
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007596	Process	Blood coagulation	TAS	2468670
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008289	Function	Lipid binding	IDA	10772654
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	10772654
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	29111364
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	10772654
GO:0010886	Process	Positive regulation of cholesterol storage	IEA
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0015911	Process	Long-chain fatty acid import across plasma membrane	IDA	24503477
GO:0015912	Process	Short-chain fatty acid transport	IMP	21395585
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2468669
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23896411
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23896411
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0019915	Process	Lipid storage	IBA
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	IMP	10772654
GO:0019934	Process	CGMP-mediated signaling	IDA	17416590
GO:0030169	Function	Low-density lipoprotein particle binding	IBA
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	10772654
GO:0030169	Function	Low-density lipoprotein particle binding	IEA
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030299	Process	Intestinal cholesterol absorption	IEA
GO:0030299	Process	Intestinal cholesterol absorption	ISS
GO:0030301	Process	Cholesterol transport	IEA
GO:0030301	Process	Cholesterol transport	ISS	12376530
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031526	Component	Brush border membrane	IEA
GO:0031526	Component	Brush border membrane	ISS
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	TAS	29111364
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0033993	Process	Response to lipid	IEA
GO:0033993	Process	Response to lipid	ISS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034197	Process	Triglyceride transport	IEA
GO:0034197	Process	Triglyceride transport	ISS
GO:0034381	Process	Plasma lipoprotein particle clearance	IEA
GO:0034381	Process	Plasma lipoprotein particle clearance	ISS	12376530
GO:0034383	Process	Low-density lipoprotein particle clearance	IBA
GO:0034383	Process	Low-density lipoprotein particle clearance	IEA
GO:0034383	Process	Low-density lipoprotein particle clearance	IMP	10772654
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035325	Function	Toll-like receptor binding	IPI	20037584
GO:0035579	Component	Specific granule membrane	TAS
GO:0035634	Process	Response to stilbenoid	IEA
GO:0038024	Function	Cargo receptor activity	IDA	32958780
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	IDA	17416590
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042953	Process	Lipoprotein transport	IBA
GO:0042953	Process	Lipoprotein transport	IEA
GO:0042953	Process	Lipoprotein transport	IMP	10772654
GO:0042953	Process	Lipoprotein transport	TAS	9568716
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	20037584
GO:0043235	Component	Receptor complex	IPI	20037584
GO:0043254	Process	Regulation of protein-containing complex assembly	IMP	20037584
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	IBA
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	17416590, 22022213
GO:0044539	Process	Long-chain fatty acid import into cell	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045121	Component	Membrane raft	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0045335	Component	Phagocytic vesicle	TAS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23896411
GO:0050431	Function	Transforming growth factor beta binding	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:0050892	Process	Intestinal absorption	ISS
GO:0050909	Process	Sensory perception of taste	IEA
GO:0050909	Process	Sensory perception of taste	ISS
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070053	Function	Thrombospondin receptor activity	IDA	9245797
GO:0070053	Function	Thrombospondin receptor activity	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070508	Process	Cholesterol import	IEA
GO:0070508	Process	Cholesterol import	ISS
GO:0070542	Process	Response to fatty acid	IEA
GO:0070542	Process	Response to fatty acid	ISS
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070543	Process	Response to linoleic acid	ISS
GO:0070892	Function	Lipoteichoic acid immune receptor activity	IEA
GO:0071221	Process	Cellular response to bacterial lipopeptide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071447	Process	Cellular response to hydroperoxide	IEA
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	ISS
GO:0071813	Function	Lipoprotein particle binding	IDA	9568716
GO:0071944	Component	Cell periphery	IDA	26449856
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0098900	Process	Regulation of action potential	IEA
GO:0098900	Process	Regulation of action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25596128
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	27607416
GO:0150024	Process	Oxidised low-density lipoprotein particle clearance	IMP	27607416
GO:0150025	Function	Oxidised low-density lipoprotein particle receptor activity	IMP	27607416
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IBA
GO:0150094	Process	Amyloid-beta clearance by cellular catabolic process	IMP	18941241
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901480	Function	Oleate transmembrane transporter activity	IDA	24503477
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	31649195
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:1990000	Process	Amyloid fibril formation	IEA
GO:1990000	Process	Amyloid fibril formation	ISS
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585
GO:2000121	Process	Regulation of removal of superoxide radicals	IEA
GO:2000334	Process	Positive regulation of blood microparticle formation	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
173510	1663	ENSG00000135218

P16671

Protein name

Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)

Protein function

Multifunctional glycoprotein that acts as a receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipopr

PDB

5LGD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01130	CD36	14 → 463	CD36 family	Family

Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Sequence length

472

Interactions

View interactions

216

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CD36-related disorder	Likely pathogenic; Pathogenic	rs748431584, rs753754773, rs2535905306, rs550565800, rs375042355, rs1451278617, rs775734577, rs772709798, rs753791074, rs2535739173, rs148051111, rs148910227	RCV003324407 RCV004741075 RCV004550744 RCV003330584 RCV004552511 RCV004554095 RCV004550603 RCV004550918 RCV004548763 RCV004551039 RCV004551576 RCV004549857
Coronary heart disease, susceptibility to, 7	Likely pathogenic; Pathogenic	rs775478465, rs572295823, rs148051111, rs3211901	RCV004796600 RCV002503831 RCV000477879 RCV005047030
Inherited bleeding disorder, platelet-type	Likely pathogenic	rs201765331	RCV004017735
Malaria, susceptibility to	Likely pathogenic; Pathogenic	rs775478465, rs572295823, rs148051111, rs766920034, rs3211901	RCV004796600 RCV002503831 RCV000477879 RCV000714683 RCV005047030
Melanoma	Likely pathogenic	rs3211901	RCV005897387
Nonpapillary renal cell carcinoma	Likely pathogenic	rs375042355	RCV005932783
Platelet-type bleeding disorder 10	Likely pathogenic; Pathogenic	rs775478465, rs748431584, rs199530093, rs757142781, rs375042355, rs753754773, rs780525946, rs149985988, rs754478799, rs751804837, rs572295823, rs550565800, rs574416705, rs1796684604, rs748289963 View all (12 more)	RCV001594440 RCV005230489 RCV005360334 RCV001780738 RCV005365640 RCV001733518 RCV005369949 RCV001780461 RCV001780463 RCV003991807 RCV001823466 RCV000490431 RCV000490260 RCV003141249 RCV003327336 RCV003388245 RCV000014497 RCV000014498 RCV000014499 RCV005358050 RCV003990516 RCV003990864 RCV004577204 RCV000477879 RCV005860133 RCV000779542 RCV000778836 RCV000853359
Sarcoma	Likely pathogenic	rs375042355	RCV005939728
See cases	Pathogenic	rs751471043	RCV004584536

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	no classification for the single variant	rs1984112, rs1049673	-
Acute myeloid leukemia	Benign; Uncertain significance	rs1527483, rs780361615	RCV005898537 RCV005913978
Cervical cancer	Uncertain significance	rs375587618	RCV005939103
Clear cell carcinoma of kidney	Uncertain significance	rs371153088	RCV005914004
Gastric cancer	Benign	rs1527483	RCV005898538
Hepatocellular carcinoma	-; Benign	rs555480623, rs1527463	RCV006005391 RCV005923538
Lung cancer	Benign; Uncertain significance	rs1527483, rs371153088	RCV005898541 RCV005914005
Malaria, cerebral, susceptibility to	Conflicting classifications of pathogenicity	rs3211938	RCV000014492
Osteopetrosis	Conflicting classifications of pathogenicity	rs201657731	RCV005235561
Ovarian serous cystadenocarcinoma	Benign	rs1527483	RCV005898539
Premature coronary artery atherosclerosis	Uncertain significance	rs1167195397	RCV003444011
Thymoma	Benign	rs1527483	RCV005898540
Type 2 diabetes mellitus	Benign	rs3211867, rs1761667	RCV002269249 RCV002268206
Uterine corpus endometrial carcinoma	Benign	rs1527483	RCV005898542

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	35666553
Adrenal Hyperplasia Congenital	Associate	36583008
Alzheimer Disease	Associate	30235742, 35768560
Anemia hypochromic microcytic	Associate	19359777
Anodontia	Associate	31185924
Arterial Occlusive Diseases	Associate	27869039
Asthma	Associate	40450010
Atherosclerosis	Associate	12419963
Blood Platelet Disorders	Associate	30721642
Carcinoma Hepatocellular	Associate	26424075
Cardiomyopathies	Associate	12419963
Cerebral Hemorrhage	Associate	28804718
Cognition Disorders	Associate	35768560
Colorectal Neoplasms	Associate	36074971
Coronary Artery Disease	Associate	22113854, 25118627, 31185924
Coronary Disease	Associate	25299084, 27461004
Crohn Disease	Associate	36608744
Diabetes Mellitus	Associate	22113854, 25132069, 25299084, 33966442, 35666553, 36031603
Diabetes Mellitus Type 2	Associate	18305138, 22194967, 32198214, 33966442, 33989714, 36031603
Disease	Associate	36608744
Dyslipidemias	Associate	35274685, 35552711, 35666553
Heart Diseases	Associate	18305138
Hypertension	Associate	30924431, 31185924
Hypertrophy Left Ventricular	Associate	21346626
Inflammation	Associate	27461004, 29257236
Inflammatory Bowel Diseases	Associate	32033224
Insulin Resistance	Associate	24784828, 33966442
Macular Degeneration	Associate	20157514, 22275803
Malaria	Associate	18305138
Mesenteric Vascular Occlusion	Associate	27869039
Metabolic Diseases	Associate	20966915, 32898636
Metabolic Syndrome	Associate	18305138, 20223461, 22047506, 30724038
Myocardial Infarction	Associate	18035074, 22113854
Neoplasms	Associate	1703153, 36074971
Non Muscle Invasive Bladder Neoplasms	Associate	34257543
Obesity	Associate	19893500, 21285405, 22113854, 22210925, 23175350, 26556365, 32198214, 32419652, 32685140, 34448000
Obesity	Inhibit	30724038
Obesity Abdominal	Associate	33612620
Ophthalmoplegia Chronic Progressive External	Associate	21515672
Overweight	Associate	32419652
Platelet Glycoprotein IV Deficiency	Associate	40450010
Polypoidal Choroidal Vasculopathy	Associate	22275803, 23213279
Thrombosis	Associate	30721642
Tuberculosis Pulmonary	Associate	28693442

CD36 (CD36 molecule (CD36 blood group))