CCNA1 (cyclin A1)

Gene
Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8900
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNA1
Synonyms (NCBI Gene) Gene synonyms aliases
CT146
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
miRNA miRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT006767 hsa-miR-372-3p FACS, GFP reporter assay, qRT-PCR, Western blot 21646351
MIRT006767 hsa-miR-372-3p FACS, GFP reporter assay, qRT-PCR, Western blot 21646351
MIRT018229 hsa-miR-335-5p Microarray 18185580
MIRT022823 hsa-miR-124-3p Microarray 18668037
MIRT032444 hsa-let-7b-5p Reporter assay 18379589
Transcription factors
Gene SNPs Transcription factors Other IDs
Show/Hide all(7)
Transcription factor Regulation Reference
ATF1 Repression 12044952
CREM Unknown 7760825
KDM4B Unknown 20682797
MYB Activation 10590070
MYBL2 Unknown 11264176;15922873
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0005515 Function Protein binding IPI 8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs
MIM HGNC e!Ensembl
604036 1577 ENSG00000133101
Protein
Gene SNPs Transcription factors Other IDs
UniProt ID P78396
Protein name Cyclin-A1
Protein function May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 214 → 340 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 342 → 459 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines. {ECO:0000269|PubMed:9041194}.
Sequence 
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Sequence length 465
Interactions View interactions
<