CCNA1 (cyclin A1)

Gene Gene information from NCBI Gene database.
Gene SNPs Transcription factors Other IDs
Entrez ID 8900
Gene name Cyclin A1
Gene symbol CCNA1
Synonyms (NCBI Gene)
CT146
Chromosome 13
Chromosome location 13q13.3
Summary The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
miRNA miRNA information provided by mirtarbase database.
5
Gene SNPs Transcription factors Other IDs
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT006767 hsa-miR-372-3p FACSGFP reporter assayqRT-PCRWestern blot 21646351
MIRT006767 hsa-miR-372-3p FACSGFP reporter assayqRT-PCRWestern blot 21646351
MIRT018229 hsa-miR-335-5p Microarray 18185580
MIRT022823 hsa-miR-124-3p Microarray 18668037
MIRT032444 hsa-let-7b-5p Reporter assay 18379589
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Gene SNPs Transcription factors Other IDs
Show/Hide all (7)
Transcription factor Regulation Reference
ATF1 Repression 12044952
CREM Unknown 7760825
KDM4B Unknown 20682797
MYB Activation 10590070
MYBL2 Unknown 11264176;15922873
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene SNPs Transcription factors Other IDs
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0005515 Function Protein binding IPI 8756624, 15159402, 15232106, 18692475, 21540187, 25241761, 29997244, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Transcription factors Other IDs
MIM HGNC e!Ensembl
604036 1577 ENSG00000133101
Protein Protein information from UniProt database.
Gene SNPs Transcription factors Other IDs
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78396
Protein name Cyclin-A1
Protein function May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 214 → 340 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 342 → 459 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines. {ECO:0000269|PubMed:9041194}.
Sequence 
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Sequence length 465
Interactions View interactions