Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83605
Gene name Gene Name - the full gene name approved by the HGNC.
CCM2 scaffold protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCM2
Synonyms (NCBI Gene) Gene synonyms aliases
C7orf22, OSM, PP10187
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a scaffold protein that functions in the stress-activated p38 Mitogen-activated protein kinase (MAPK) signaling cascade. The protein interacts with SMAD specific E3 ubiquitin protein ligase 1 (also known as SMURF1) via a phosphotyrosine
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137852841 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs137852843 T>G Pathogenic Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs755800734 C>T Pathogenic Intron variant, coding sequence variant, non coding transcript variant, stop gained
rs765548101 C>G,T Pathogenic Non coding transcript variant, coding sequence variant, stop gained, synonymous variant
rs886041157 C>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT871135 hsa-miR-1323 CLIP-seq
MIRT871136 hsa-miR-19a CLIP-seq
MIRT871137 hsa-miR-19b CLIP-seq
MIRT871138 hsa-miR-2277-3p CLIP-seq
MIRT871139 hsa-miR-3607-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001568 Process Blood vessel development IEA
GO:0001570 Process Vasculogenesis IBA
GO:0001570 Process Vasculogenesis IEA
GO:0001570 Process Vasculogenesis IMP 14740320
GO:0001701 Process In utero embryonic development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607929 21708 ENSG00000136280
Protein
UniProt ID Q9BSQ5
Protein name Cerebral cavernous malformations 2 protein (Malcavernin)
Protein function Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity. May act through the stabilization of endothelial cell junctions (By similarity). May function as a scaffold protein for MAP2K3-MAP3K
PDB 4FQN , 4TVQ , 4WJ7 , 4Y5O , 4YKC , 4YKD , 4YL6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16545 CCM2_C 287 387 Cerebral cavernous malformation protein, harmonin-homology Domain
Sequence
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLS
DYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNV
KLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAG
SLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTP
THHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ
DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEK
DSQHFENFLETIGVKDGRGIITDSFGR
HRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA
Sequence length 444
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cerebral Cavernous Malformation Cerebral cavernous malformation 2 rs1795541254, rs1554365511, rs1562913873, rs1554365507, rs1562917629, rs1562848466, rs1554377652, rs1331484727, rs137852841, rs1562912426, rs1562881854, rs137852842, rs1562906798, rs1583970495, rs1562906981
View all (15 more)
N/A
cavernous hemangioma Cavernous hemangioma rs765548101 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 35431232
Carotid Artery Diseases Associate 35370030
Cerebral Cavernous Malformations 2 Associate 28387648, 32186778
Cerebral Hemorrhage Associate 35370030
Cerebral Palsy Associate 27277535
Cognition Disorders Associate 27277535
Corneal Endothelial Cell Loss Associate 20181950
Coronary Artery Disease Associate 38326615
Epilepsy Associate 32702807
Familial cerebral cavernous malformation Associate 22773461, 32702807, 36629374, 38420834