Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6347
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL2
Synonyms (NCBI Gene) Gene synonyms aliases
GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004284 hsa-miR-124-3p Luciferase reporter assay 19404929
MIRT021047 hsa-miR-155-5p Proteomics 18668040
MIRT024058 hsa-miR-1-3p Microarray 18668037
MIRT030277 hsa-miR-26b-5p Microarray 19088304
MIRT030558 hsa-miR-24-3p Microarray 19748357
Transcription factors
Transcription factor Regulation Reference
APEX1 Activation 17045925
ATF4 Unknown 16931790
CEBPA Activation 24429361
HDAC2 Unknown 22679019
IRF3 Unknown 20483755
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis TAS 18334747
GO:0002548 Process Monocyte chemotaxis IDA 12207323
GO:0004672 Function Protein kinase activity TAS 9973507
GO:0005102 Function Signaling receptor binding TAS 10542238
GO:0005125 Function Cytokine activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
158105 10618 ENSG00000108691
Protein
UniProt ID P13500
Protein name C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
Protein function Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
PDB 1DOK , 1DOL , 1DOM , 1DON , 1ML0 , 2BDN , 2NZ1 , 3IFD , 4DN4 , 4R8I , 4ZK9 , 7SO0 , 7XA3 , 8FJ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 32 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) (PubMed:23765988). Expressed in monocytes (PubMed:2513477). {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2513477}.
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHL
DKQTQTPKT
Sequence length 99
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease (MTAG) N/A N/A GWAS
Neural Tube Defect neural tube defects, susceptibility to N/A N/A GenCC
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Pain Associate 30918467
Acidosis Associate 38069241
Acquired Immunodeficiency Syndrome Associate 11931709
Acquired Immunodeficiency Syndrome Stimulate 26475133
Acute Coronary Syndrome Stimulate 20061546
Acute Coronary Syndrome Associate 35563407
Acute Febrile Encephalopathy Stimulate 15608388
Acute Febrile Encephalopathy Associate 22012040
Acute Kidney Injury Stimulate 18784644, 23511138, 33348065
Acute Kidney Injury Associate 28640195, 33974569