Gene Gene information from NCBI Gene database.
Entrez ID 6347
Gene name C-C motif chemokine ligand 2
Gene symbol CCL2
Synonyms (NCBI Gene)
GDCF-2HC11HSMCR30MCAFMCP-1MCP1SCYA2SMC-CF
Chromosome 17
Chromosome location 17q12
Summary This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar
miRNA miRNA information provided by mirtarbase database.
34
miRTarBase ID miRNA Experiments Reference
MIRT004284 hsa-miR-124-3p Luciferase reporter assay 19404929
MIRT021047 hsa-miR-155-5p Proteomics 18668040
MIRT024058 hsa-miR-1-3p Microarray 18668037
MIRT030277 hsa-miR-26b-5p Microarray 19088304
MIRT030558 hsa-miR-24-3p Microarray 19748357
Transcription factors Transcription factors information provided by TRRUST V2 database.
22
Transcription factor Regulation Reference
APEX1 Activation 17045925
ATF4 Unknown 16931790
CEBPA Activation 24429361
HDAC2 Unknown 22679019
IRF3 Unknown 20483755
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
73
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis TAS 18334747
GO:0002548 Process Monocyte chemotaxis IDA 12207323
GO:0004672 Function Protein kinase activity TAS 9973507
GO:0005102 Function Signaling receptor binding TAS 10542238
GO:0005125 Function Cytokine activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
158105 10618 ENSG00000108691
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13500
Protein name C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
Protein function Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
PDB 1DOK , 1DOL , 1DOM , 1DON , 1ML0 , 2BDN , 2NZ1 , 3IFD , 4DN4 , 4R8I , 4ZK9 , 7SO0 , 7XA3 , 8FJ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 32 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) (PubMed:23765988). Expressed in monocytes (PubMed:2513477). {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2513477}.
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHL
DKQTQTPKT
Sequence length 99
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CCL2-related disorder Uncertain significance; Benign; Likely benign rs1024611, rs4586, rs138768575 RCV003974826
RCV003979697
RCV003911900
Spina bifida, susceptibility to Uncertain significance rs1024611 RCV000015271
Susceptibility to HIV infection protective rs1024610, rs2857657 RCV000015269
RCV000015270
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Pain Associate 30918467
Acidosis Associate 38069241
Acquired Immunodeficiency Syndrome Associate 11931709
Acquired Immunodeficiency Syndrome Stimulate 26475133
Acute Coronary Syndrome Stimulate 20061546
Acute Coronary Syndrome Associate 35563407
Acute Febrile Encephalopathy Stimulate 15608388
Acute Febrile Encephalopathy Associate 22012040
Acute Kidney Injury Stimulate 18784644, 23511138, 33348065
Acute Kidney Injury Associate 28640195, 33974569