Gene Gene information from NCBI Gene database.
Entrez ID 10645
Gene name Calcium/calmodulin dependent protein kinase kinase 2
Gene symbol CAMKK2
Synonyms (NCBI Gene)
CAMKKCAMKKB
Chromosome 12
Chromosome location 12q24.31
Summary The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosph
miRNA miRNA information provided by mirtarbase database.
264
miRTarBase ID miRNA Experiments Reference
MIRT027179 hsa-miR-103a-3p Sequencing 20371350
MIRT031851 hsa-miR-16-5p Sequencing 20371350
MIRT048541 hsa-miR-100-5p CLASH 23622248
MIRT045326 hsa-miR-185-5p CLASH 23622248
MIRT688870 hsa-miR-6854-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS 11395482
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615002 1470 ENSG00000110931
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96RR4
Protein name Calcium/calmodulin-dependent protein kinase kinase 2 (CaM-KK 2) (CaM-kinase kinase 2) (CaMKK 2) (EC 2.7.11.17) (Calcium/calmodulin-dependent protein kinase kinase beta) (CaM-KK beta) (CaM-kinase kinase beta) (CaMKK beta)
Protein function Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D
PDB 2ZV2 , 5UY6 , 5UYJ , 5VT1 , 5YV8 , 5YV9 , 5YVA , 5YVB , 5YVC , 6BKU , 6BLE , 6BQL , 6BQP , 6BQQ , 6BRC , 6CMJ , 6EF5 , 6EWW , 6FEL , 6Y3O , 6Y4K , 6Y6B , 6Y8A , 8TUC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 165 446 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung. {ECO:0000269|PubMed:9662074}.
Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWV
TRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
Sequence length 588
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Benign rs891780 RCV005903667
Thyroid cancer, nonmedullary, 1 Benign rs891780 RCV005903668
Uterine corpus endometrial carcinoma Benign rs891780 RCV005903669
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abidi X linked mental retardation syndrome Associate 28737528
AIDS Associated Nephropathy Associate 37166584
Alopecia Associate 35438341
Anxiety Associate 33082841
Bipolar Disorder Associate 33082841
Breast Neoplasms Associate 37661833
Carcinogenesis Associate 34725334
Cerebral Infarction Associate 22662160
Cholangiocarcinoma Associate 38082327
Cystic Fibrosis Associate 24859760