Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	815
Gene name	Calcium/calmodulin dependent protein kinase II alpha
Gene symbol	CAMK2A
Synonyms (NCBI Gene)	CAMKACaMKIINalphaCaMKIIalphaMRD53MRT63
Chromosome	5
Chromosome location	5q32
Summary	The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmo

Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113331868	C>A,T	Pathogenic	Splice donor variant
rs864309606	G>A	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs926027867	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs1287121256	C>G,T	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs1554119274	G>A	Pathogenic	Coding sequence variant, missense variant
rs1554121872	T>G	Pathogenic	Coding sequence variant, missense variant
rs1554121875	T>C	Pathogenic	Coding sequence variant, missense variant
rs1554121878	C>T	Pathogenic	Splice acceptor variant
rs1554122123	->A	Likely-pathogenic	Splice donor variant
rs1554122129	T>A	Pathogenic	Coding sequence variant, missense variant
rs1554122526	A>G	Pathogenic	Coding sequence variant, missense variant
rs1554123982	C>-	Likely-pathogenic	Coding sequence variant, splice acceptor variant
rs1562164380	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1580966945	C>T	Likely-pathogenic	Missense variant, coding sequence variant

192

Show/Hide all (192)

miRTarBase ID	miRNA	Experiments	Reference
MIRT529406	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT529405	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT529404	hsa-miR-1251-3p	PAR-CLIP	22012620
MIRT457398	hsa-miR-4688	PAR-CLIP	23592263
MIRT457397	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT457396	hsa-miR-4534	PAR-CLIP	23592263
MIRT457395	hsa-miR-8082	PAR-CLIP	23592263
MIRT457394	hsa-miR-3665	PAR-CLIP	23592263
MIRT457393	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT457392	hsa-miR-4736	PAR-CLIP	23592263
MIRT457391	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT457390	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT457389	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT457388	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT457387	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT457386	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457385	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT457384	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT457383	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT457382	hsa-miR-5698	PAR-CLIP	23592263
MIRT457381	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT457379	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT457380	hsa-miR-4525	PAR-CLIP	23592263
MIRT457378	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT457377	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT457376	hsa-miR-4447	PAR-CLIP	23592263
MIRT457375	hsa-miR-4472	PAR-CLIP	23592263
MIRT457374	hsa-miR-1275	PAR-CLIP	23592263
MIRT457373	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT736819	hsa-miR-146a-3p	qRT-PCR	31555879
MIRT529406	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT529405	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT529404	hsa-miR-1251-3p	PAR-CLIP	22012620
MIRT457398	hsa-miR-4688	PAR-CLIP	23592263
MIRT457397	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT457396	hsa-miR-4534	PAR-CLIP	23592263
MIRT457395	hsa-miR-8082	PAR-CLIP	23592263
MIRT457394	hsa-miR-3665	PAR-CLIP	23592263
MIRT457393	hsa-miR-505-5p	PAR-CLIP	23592263
MIRT457392	hsa-miR-4736	PAR-CLIP	23592263
MIRT457391	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT457390	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT457389	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT457388	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT457387	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT457386	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457385	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT457384	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT457383	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT457382	hsa-miR-5698	PAR-CLIP	23592263
MIRT457381	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT457379	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT457380	hsa-miR-4525	PAR-CLIP	23592263
MIRT457378	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT457377	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT457376	hsa-miR-4447	PAR-CLIP	23592263
MIRT457375	hsa-miR-4472	PAR-CLIP	23592263
MIRT457374	hsa-miR-1275	PAR-CLIP	23592263
MIRT457373	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT755478	hsa-miR-3200-3p	Luciferase reporter assayWestern blottingqRT-PCRin vitro cullelar assays	35287547
MIRT860097	hsa-miR-1207-5p	CLIP-seq
MIRT860098	hsa-miR-127-5p	CLIP-seq
MIRT860099	hsa-miR-1287	CLIP-seq
MIRT860100	hsa-miR-1909	CLIP-seq
MIRT860101	hsa-miR-3128	CLIP-seq
MIRT860102	hsa-miR-3135b	CLIP-seq
MIRT860103	hsa-miR-3175	CLIP-seq
MIRT860104	hsa-miR-3676	CLIP-seq
MIRT860105	hsa-miR-3689d	CLIP-seq
MIRT860106	hsa-miR-409-3p	CLIP-seq
MIRT860107	hsa-miR-4443	CLIP-seq
MIRT860108	hsa-miR-4470	CLIP-seq
MIRT860109	hsa-miR-4487	CLIP-seq
MIRT860110	hsa-miR-4646-5p	CLIP-seq
MIRT860111	hsa-miR-4763-3p	CLIP-seq
MIRT860112	hsa-miR-4781-3p	CLIP-seq
MIRT860113	hsa-miR-4786-3p	CLIP-seq
MIRT860114	hsa-miR-569	CLIP-seq
MIRT860115	hsa-miR-657	CLIP-seq
MIRT860116	hsa-miR-1245b-5p	CLIP-seq
MIRT860098	hsa-miR-127-5p	CLIP-seq
MIRT860117	hsa-miR-3123	CLIP-seq
MIRT860118	hsa-miR-3125	CLIP-seq
MIRT860119	hsa-miR-3142	CLIP-seq
MIRT860120	hsa-miR-3150b-3p	CLIP-seq
MIRT860121	hsa-miR-3153	CLIP-seq
MIRT860122	hsa-miR-3179	CLIP-seq
MIRT860123	hsa-miR-3189-3p	CLIP-seq
MIRT860124	hsa-miR-3916	CLIP-seq
MIRT860125	hsa-miR-4311	CLIP-seq
MIRT860126	hsa-miR-4459	CLIP-seq
MIRT860109	hsa-miR-4487	CLIP-seq
MIRT860127	hsa-miR-4532	CLIP-seq
MIRT860110	hsa-miR-4646-5p	CLIP-seq
MIRT860128	hsa-miR-4695-5p	CLIP-seq
MIRT860129	hsa-miR-4707-5p	CLIP-seq
MIRT860130	hsa-miR-4784	CLIP-seq
MIRT860113	hsa-miR-4786-3p	CLIP-seq
MIRT860131	hsa-miR-541	CLIP-seq
MIRT860132	hsa-miR-583	CLIP-seq
MIRT860133	hsa-miR-654-5p	CLIP-seq
MIRT860134	hsa-miR-7	CLIP-seq
MIRT860135	hsa-miR-767-5p	CLIP-seq
MIRT1955234	hsa-miR-103a	CLIP-seq
MIRT1955235	hsa-miR-107	CLIP-seq
MIRT1955236	hsa-miR-1270	CLIP-seq
MIRT860099	hsa-miR-1287	CLIP-seq
MIRT1955237	hsa-miR-138	CLIP-seq
MIRT1955238	hsa-miR-1827	CLIP-seq
MIRT1955239	hsa-miR-2110	CLIP-seq
MIRT860101	hsa-miR-3128	CLIP-seq
MIRT860102	hsa-miR-3135b	CLIP-seq
MIRT1955240	hsa-miR-3150a-3p	CLIP-seq
MIRT860103	hsa-miR-3175	CLIP-seq
MIRT1955241	hsa-miR-326	CLIP-seq
MIRT1955242	hsa-miR-330-5p	CLIP-seq
MIRT1955243	hsa-miR-331-3p	CLIP-seq
MIRT1955244	hsa-miR-3614-5p	CLIP-seq
MIRT1955245	hsa-miR-3670	CLIP-seq
MIRT860104	hsa-miR-3676	CLIP-seq
MIRT1955246	hsa-miR-4299	CLIP-seq
MIRT1955247	hsa-miR-432	CLIP-seq
MIRT1955248	hsa-miR-4480	CLIP-seq
MIRT1955249	hsa-miR-4531	CLIP-seq
MIRT1955250	hsa-miR-4720-5p	CLIP-seq
MIRT1955251	hsa-miR-4727-5p	CLIP-seq
MIRT1955252	hsa-miR-4769-3p	CLIP-seq
MIRT1955253	hsa-miR-4799-3p	CLIP-seq
MIRT1955254	hsa-miR-509-3p	CLIP-seq
MIRT1955255	hsa-miR-593	CLIP-seq
MIRT1955256	hsa-miR-620	CLIP-seq
MIRT1955257	hsa-miR-890	CLIP-seq
MIRT1955258	hsa-miR-939	CLIP-seq
MIRT1955259	hsa-miR-942	CLIP-seq
MIRT860099	hsa-miR-1287	CLIP-seq
MIRT2192951	hsa-miR-137	CLIP-seq
MIRT1955237	hsa-miR-138	CLIP-seq
MIRT2192952	hsa-miR-148a	CLIP-seq
MIRT2192953	hsa-miR-148b	CLIP-seq
MIRT2192954	hsa-miR-152	CLIP-seq
MIRT1955239	hsa-miR-2110	CLIP-seq
MIRT2192955	hsa-miR-25	CLIP-seq
MIRT860102	hsa-miR-3135b	CLIP-seq
MIRT1955240	hsa-miR-3150a-3p	CLIP-seq
MIRT860103	hsa-miR-3175	CLIP-seq
MIRT2192956	hsa-miR-32	CLIP-seq
MIRT2192957	hsa-miR-342-5p	CLIP-seq
MIRT2192958	hsa-miR-363	CLIP-seq
MIRT2192959	hsa-miR-367	CLIP-seq
MIRT1955245	hsa-miR-3670	CLIP-seq
MIRT860104	hsa-miR-3676	CLIP-seq
MIRT1955246	hsa-miR-4299	CLIP-seq
MIRT2192960	hsa-miR-4325	CLIP-seq
MIRT2192961	hsa-miR-4651	CLIP-seq
MIRT2192962	hsa-miR-4664-5p	CLIP-seq
MIRT2192963	hsa-miR-4691-5p	CLIP-seq
MIRT2192964	hsa-miR-4697-3p	CLIP-seq
MIRT860129	hsa-miR-4707-5p	CLIP-seq
MIRT2192965	hsa-miR-4713-5p	CLIP-seq
MIRT2192966	hsa-miR-4787-5p	CLIP-seq
MIRT2192967	hsa-miR-491-5p	CLIP-seq
MIRT1955254	hsa-miR-509-3p	CLIP-seq
MIRT2192968	hsa-miR-512-3p	CLIP-seq
MIRT860131	hsa-miR-541	CLIP-seq
MIRT2192969	hsa-miR-570	CLIP-seq
MIRT2192970	hsa-miR-608	CLIP-seq
MIRT860133	hsa-miR-654-5p	CLIP-seq
MIRT860135	hsa-miR-767-5p	CLIP-seq
MIRT2192971	hsa-miR-92a	CLIP-seq
MIRT2192972	hsa-miR-92b	CLIP-seq
MIRT1955258	hsa-miR-939	CLIP-seq
MIRT2385493	hsa-miR-1290	CLIP-seq
MIRT2385494	hsa-miR-3167	CLIP-seq
MIRT2385495	hsa-miR-4540	CLIP-seq
MIRT2385496	hsa-miR-629	CLIP-seq
MIRT2385497	hsa-miR-876-5p	CLIP-seq
MIRT2385498	hsa-miR-1324	CLIP-seq
MIRT2385499	hsa-miR-3166	CLIP-seq
MIRT2436039	hsa-miR-338-3p	CLIP-seq
MIRT2436040	hsa-miR-4530	CLIP-seq
MIRT2436041	hsa-miR-4668-3p	CLIP-seq
MIRT2436042	hsa-miR-545	CLIP-seq
MIRT2436043	hsa-miR-548p	CLIP-seq
MIRT2436039	hsa-miR-338-3p	CLIP-seq
MIRT2436040	hsa-miR-4530	CLIP-seq
MIRT2436041	hsa-miR-4668-3p	CLIP-seq
MIRT2436042	hsa-miR-545	CLIP-seq
MIRT2436043	hsa-miR-548p	CLIP-seq
MIRT2496004	hsa-miR-4293	CLIP-seq
MIRT2496005	hsa-miR-625	CLIP-seq
MIRT2496004	hsa-miR-4293	CLIP-seq
MIRT2496005	hsa-miR-625	CLIP-seq

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	28130356
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IBA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IDA	11972023, 35568036
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	TAS	11972023
GO:0005515	Function	Protein binding	IPI	17052756, 19453375, 20668654, 22939624, 25852190, 27173435, 28130356, 29426014, 31980649, 32296183, 32707033, 32814053, 33961781, 36931259
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	IPI	20668654
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005954	Component	Calcium- and calmodulin-dependent protein kinase complex	IDA	20668654, 28130356
GO:0005954	Component	Calcium- and calmodulin-dependent protein kinase complex	IEA
GO:0006468	Process	Protein phosphorylation	IDA	17052756
GO:0006816	Process	Calcium ion transport	ISS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	11972023, 28753426
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	ISS
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016301	Function	Kinase activity	IDA	17052756
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030666	Component	Endocytic vesicle membrane	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0035254	Function	Glutamate receptor binding	ISS
GO:0035458	Process	Cellular response to interferon-beta	IDA	28753426
GO:0035458	Process	Cellular response to interferon-beta	IDA	35568036
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	20584908
GO:0042802	Function	Identical protein binding	IPI	20668654, 21884935
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20668654
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043197	Component	Dendritic spine	IDA	28130356
GO:0043197	Component	Dendritic spine	IEA
GO:0045202	Component	Synapse	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16257975
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	11972023, 35568036
GO:0046872	Function	Metal ion binding	IEA
GO:0046928	Process	Regulation of neurotransmitter secretion	ISS
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IBA
GO:0048168	Process	Regulation of neuronal synaptic plasticity	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	17052756
GO:0051346	Process	Negative regulation of hydrolase activity	ISS
GO:0051928	Process	Positive regulation of calcium ion transport	ISS
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	TAS	20668654
GO:0060996	Process	Dendritic spine development	IMP	28130356
GO:0071346	Process	Cellular response to type II interferon	IDA	11972023
GO:0071346	Process	Cellular response to type II interferon	IDA	11972023
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902108	Process	Regulation of mitochondrial membrane permeability involved in apoptotic process	ISS
GO:1903076	Process	Regulation of protein localization to plasma membrane	IBA
GO:1990443	Process	Peptidyl-threonine autophosphorylation	IMP	28130356
GO:2000124	Process	Regulation of endocannabinoid signaling pathway	ISS
GO:2001222	Process	Regulation of neuron migration	IMP	29100089

MIM	HGNC	e!Ensembl
114078	1460	ENSG00000070808

Q9UQM7

Protein name

Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17)

Protein function

Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in various processes, such as synaptic plasticity, neurotransmitter release and long-term potentiati

PDB

2VZ6 , 3SOA , 5IG3 , 6OF8 , 6VZK , 6W4O , 6W4P , 6X5G , 6X5Q , 7KL0 , 7KL1 , 7KL2 , 7REC , 7UIQ , 7UIR , 7UIS , 7UJP , 7UJQ , 7UJR , 7UJS , 7UJT , 9EOY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	13 → 271	Protein kinase domain	Domain
PF08332	CaMKII_AD	346 → 473	Calcium/calmodulin dependent protein kinase II association domain	Domain

Sequence

MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH

Sequence length

478

Interactions

View interactions

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Global developmental delay	Likely pathogenic	rs1580966945	RCV001255385
Intellectual disability	Pathogenic; Likely pathogenic	rs1554121872, rs1554121875, rs926027867, rs1554122123, rs1554122129, rs1287121256, rs1554122526, rs1554123982	RCV000577925 RCV000577902 RCV000577918 RCV000577905 RCV000577883 RCV000577915 RCV000577897 RCV000577878
Intellectual disability, autosomal dominant 53	Likely pathogenic; Pathogenic	rs2150280830, rs2150315525, rs2150279502, rs2532315012, rs2532319609, rs2532312025, rs2532311966, rs1554121872, rs1554121875, rs926027867, rs1554122129, rs1287121256, rs1554122526, rs1554121878, rs1580966945, rs61732056 View all (1 more)	RCV001507313 RCV001706924 RCV002274473 RCV002468817 RCV003149128 RCV003149129 RCV003761181 RCV000516152 RCV000516155 RCV002470885 RCV000516153 RCV000516151 RCV000516156 RCV000678211 RCV000678213 RCV000824996 RCV001270422
Intellectual disability, autosomal recessive 63	Likely pathogenic; Pathogenic	rs2532327182, rs1554119274, rs61732056	RCV004560490 RCV000678210 RCV001270422

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Autism spectrum disorder	Uncertain significance	rs2150279471	RCV003125908
CAMK2A-related disorder	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	rs200745191, rs372258019, rs2532303477, rs186348077, rs201063740, rs55856831	RCV003938616 RCV003941144 RCV003966284 RCV003904633 RCV003973907 RCV003961937
Neurodevelopmental disorder	Uncertain significance	rs2481475962	RCV003389159

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	21811019
Arthritis Rheumatoid	Associate	33673283
Autism Spectrum Disorder	Associate	37510258
Bipolar Disorder	Associate	25730879, 27063557
Brain Diseases	Associate	37510258
Carcinogenesis	Associate	30220561
Cerebral Hemorrhage	Associate	36854487
Congenital Abnormalities	Associate	37510258
Developmental Disabilities	Associate	23695276, 29784083, 37510258
Drug Resistant Epilepsy	Associate	40646440
Edema	Associate	25069764
Epilepsy rolandic with paroxysmal exercise induced dystonia and writer's cramp	Associate	40646440
Glioblastoma	Associate	29393370
Glioma	Stimulate	33765507
Glioma	Associate	35287547, 37336288
Growth Disorders	Associate	29784083
Hyperhomocysteinemia	Inhibit	36854487
Hyperkinesis	Associate	37510258
Hypoxia	Associate	36709476, 38188159
Hypoxia Brain	Associate	38188159
Intellectual Disability	Associate	23695276, 29784083, 34946860, 37510258
Language Development Disorders	Associate	37510258
Mandibulofacial Dysostosis	Associate	23695276, 25790162
Meningioma	Associate	39738767
Mental Retardation Autosomal Recessive 4	Associate	29784083
Mental Retardation X Linked 53	Associate	37510258
Metabolic Syndrome	Associate	38291185
Moyamoya Disease	Associate	23518061
Neoplasm Metastasis	Associate	35287547
Neoplasms	Associate	30220561
Neurodevelopmental Disorders	Associate	29784083
Neurologic Manifestations	Associate	29784083
Osteoarthritis	Associate	29806631
Personality Disorders	Associate	37510258
Pulmonary Disease Chronic Obstructive	Associate	29547942
Reperfusion Injury	Associate	38188159
Retrograde Degeneration	Associate	29784083
Seizures	Associate	29784083, 37510258

CAMK2A (calcium/calmodulin dependent protein kinase II alpha)